KEGG   Lactuca sativa (garden lettuce): 111908098Help
Entry
111908098         CDS       T05352                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00480  Glutathione metabolism
lsv00590  Arachidonic acid metabolism
lsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111908098
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111908098
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111908098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 111908098
NCBI-ProteinID: XP_023759711
Position
Unknown
AA seq 243 aa AA seqDB search
MASMPCSSNLTSPLFDFSKSNRTHQPFCLSLPSCSTVTSIKSLLASSNSGFFQHGFALKA
GISSGVSSNSRSQFGVFAAATTGKSIYDFTVKDIDRKEVPLSKYKGKVLLIVNVASQCGL
TTSNYSELSQIYNKYKDQGLEILAFPCNQFGFQEPGSNDQIKQFACTRFKAEFPIFDKVD
VNGPFTAPIYQFLKSSTGGLLGDLVKWNFEKFLVDKSGKVVERYLPTTSPLQIEKDIRKL
VAA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatgccttgctcttcaaatctcacttccccacttttcgatttctctaaatcc
aaccgaacccatcaaccgttttgcctctctcttccctcttgttctacagttacttccatt
aaatcgttgttagcgtcatcaaattcagggtttttccaacatgggtttgctctaaaagct
gggatttcctctggggtttcgtcgaattctcgatctcaatttggggtttttgctgcagcc
accacaggaaagagtatctatgattttactgtaaaggatattgatcgaaaggaggttcct
ctttccaaatacaagggaaaggttttgttaatcgttaatgttgcatcacaatgtggtttg
acgacatcaaactactcagagctctctcaaatctataacaagtacaaagatcaaggtctt
gaaatcctggcatttccctgcaatcagtttgggttccaagaacctggctcaaatgatcag
attaaacaatttgcttgtacaaggttcaaagcagagttcccaatttttgataaggttgat
gtaaacggcccattcacagccccaatttatcagtttctcaaatcaagcacaggaggatta
ttaggcgatttggtgaagtggaattttgagaagtttttagtagataaatctggaaaagtc
gttgaaagataccttcctactacttcccctctccagattgagaaggacatacggaagctt
gttgcagcataa

DBGET integrated database retrieval system