KEGG   Lactuca sativa (garden lettuce): 111910340Help
Entry
111910340         CDS       T05352                                 

Definition
(RefSeq) aldehyde dehydrogenase family 7 member B4
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00053  Ascorbate and aldarate metabolism
lsv00071  Fatty acid degradation
lsv00260  Glycine, serine and threonine metabolism
lsv00280  Valine, leucine and isoleucine degradation
lsv00310  Lysine degradation
lsv00330  Arginine and proline metabolism
lsv00340  Histidine metabolism
lsv00380  Tryptophan metabolism
lsv00410  beta-Alanine metabolism
lsv00561  Glycerolipid metabolism
lsv00620  Pyruvate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Module
lsv_M00555  Betaine biosynthesis, choline => betaine
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111910340
   00053 Ascorbate and aldarate metabolism
    111910340
   00620 Pyruvate metabolism
    111910340
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111910340
   00561 Glycerolipid metabolism
    111910340
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    111910340
   00280 Valine, leucine and isoleucine degradation
    111910340
   00310 Lysine degradation
    111910340
   00330 Arginine and proline metabolism
    111910340
   00340 Histidine metabolism
    111910340
   00380 Tryptophan metabolism
    111910340
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    111910340
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     111910340
    1.2.1.8  betaine-aldehyde dehydrogenase
     111910340
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     111910340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 111910340
NCBI-ProteinID: XP_023761937
Position
Unknown
AA seq 508 aa AA seqDB search
MGFAKEYEFLTEIGIEPRNSGAFVNGVWKGSGSVVSSVNPANNKTIAEVVEASSQDYEEG
IKACYEASKIWMQLPAPKRGEIVRQIGDALRTKLQYLGRLLSLEMGKILPEGIGEVQEVI
DMCDFAVGLSRQLNGSVVPSERPNHMMLEMWNPLGVVGVITAFNFPCAVLGWNACIALVC
GNAVVWKGAPTTPLITIAMTKLVAEVLEKNSLPTAIFTSFCGGAEIGQAISKDTRIPLVS
FTGSSKVGQMVQQTVSERFGKCLLELSGNNALIVMDDADIQLAVRSVLFAAVGTAGQRCT
TCRRLLVHEKIYDSVVDKLLEAYKQVKVGDPLENGTLLGPLHTKASRENFEKGIKVIKSQ
GGKILTGGSVIESEGNFVQPTIVEISPSADVVKEELFGPVLYVLKFKDFKEAVEINNSVP
QGLSSSIFTRSHELIFKWIGPQGSDCGIVNVNIPTNGAEIGGAFGGEKGTGGGREAGSDS
WKQYMRRSTCTINYGSELPLAQGISFGN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgccaaggagtacgagttcttaaccgagattggtatcgagcctcgaaattct
ggtgcctttgttaatggtgtttggaaagggagtggttctgttgtctcctctgttaatcct
gcaaacaacaagaccattgctgaagtagtagaagcttcttctcaagattatgaagaaggc
ataaaggcttgttatgaagcctcaaagatttggatgcaacttcctgcaccaaagcgaggc
gagattgttagacagattggtgatgcactaagaaccaagcttcagtaccttggtagactt
ctatcacttgaaatgggaaaaattcttccagaaggaataggagaagttcaagaagtcatt
gatatgtgtgactttgcagtgggcttaagccgacaattaaacggatctgtggtaccttct
gaacgtccaaatcatatgatgcttgagatgtggaatcctcttggagtagttggtgttatt
acagccttcaattttccttgtgctgttcttggatggaatgcatgcattgctctagtctgt
ggaaatgctgttgtttggaaaggtgccccaaccacacctttaataacaatagcaatgact
aagctagttgcagaagtgctggaaaaaaacagtttaccaactgccattttcacctcattt
tgtgggggtgctgaaattggtcaagccatatcaaaagacacacgcatacccttggtttca
ttcactggaagttcaaaggttggtcagatggttcaacagactgtgagtgagagatttggt
aaatgtctgcttgaattaagtggaaataatgctttaattgtaatggatgatgccgacatt
cagcttgctgttcgctctgttctatttgctgctgttggtacagctggacaacgctgcact
acatgtcgtagacttcttgttcatgaaaagatatacgactctgtagtcgataaattactt
gaagcatataagcaagttaaagtaggtgatcctttagaaaatggcaccttgcttggacct
ttgcatacaaaagcatcaagggagaattttgagaagggcataaaggtcattaagtctcag
ggagggaaaatcctcaccggtggttcggttatagaatctgagggaaactttgtacagccg
acaatagttgagatttcaccaagtgctgatgttgtgaaggaagaactgtttggtcctgta
ctttatgtactaaaatttaaggattttaaagaagctgttgagataaacaattctgtacct
caaggattgtcaagttctattttcacccgctcacatgaacttatctttaaatggattgga
cctcaaggaagcgattgtggtattgttaatgtaaatataccaacaaatggtgctgaaatt
ggcggtgcttttggtggtgagaaggggacaggtggtggccgtgaagccggaagcgattct
tggaaacagtatatgagacgctcgacttgtacgatcaattatgggagcgagctaccactt
gcacaaggaatcagctttgggaattaa

DBGET integrated database retrieval system