KEGG   Lactuca sativa (garden lettuce): 111912758Help
Entry
111912758         CDS       T05352                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic-like
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00900  Terpenoid backbone biosynthesis
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Module
lsv_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    111912758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:lsv01006]
    111912758
Enzymes [BR:lsv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     111912758
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     111912758
    2.5.1.29  geranylgeranyl diphosphate synthase
     111912758
Prenyltransferases [BR:lsv01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   111912758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 111912758
NCBI-ProteinID: XP_023764268
Position
Unknown
AA seq 294 aa AA seqDB search
MLFLPLKLQCLLTMASVRLSFSGINLRCPSTSPARSAYIKPTIVSAGVAQNLSYWDSIHS
DIDFHLKKALPIREPISVFEPMHHLVFAPPKTTASALCVAACELVGGNREDAIVAASAIH
LMHAAIYTHDHLMLTDSDQKTPHRFGPNIELLTGDGIFPFGFELLAASMDPAGDNSDKIL
RVIIEITRAAGLQGIVNGQDSDVEFDQSGGQTRRSLHGCGAACGAILGGGSDDEIERLRR
YGVYAGKIQGLLSEIGRKERGKLELVEKWRALALKELEYLDSKRIEQISIIVRV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctttttcttcctctgaaactccagtgtctgttaacaatggccagtgttcgtctttca
ttctccggaataaatctaagatgtccatccacatcaccggcacggtcagcttacattaaa
ccgacgatcgtctccgccggagtggcccaaaacctatcgtactgggattccatacattcc
gatatcgacttccacctgaaaaaagccctccccatccgtgaacccatctccgttttcgag
ccgatgcaccacttggtatttgcgccacccaaaaccaccgcatcggcgttgtgcgtcgct
gcgtgtgagcttgtcggtggcaaccgggaagatgcaattgtagcagcgtcggcaattcac
ctcatgcatgcggctatatacacccatgaccacctcatgttaacggactccgaccagaaa
actcctcacaggtttggtcccaatatcgagcttctcaccggagatggtatttttccgttt
gggttcgagttactcgcggcgtccatggatccagccggagataactccgacaaaatactg
agggtgatcatagagattacccgagccgccggtcttcaaggaatcgtcaacggtcaagat
tctgacgttgaatttgaccaatcgggtggtcaaacacgacggagtcttcatggttgtggg
gccgcctgcggagccatattaggtggtgggagcgacgatgagattgaaaggttgagaaga
tatggagtctatgctggcaaaatacaaggacttttaagtgaaattggtagaaaggaaagg
ggtaaactagaattagtagagaaatggagggctttggctctaaaagagttggaatatctt
gacagcaaaagaattgagcaaatttcaataattgtgagagtctaa

DBGET integrated database retrieval system