KEGG   Lactuca sativa (garden lettuce): 111914654Help
Entry
111914654         CDS       T05352                                 

Definition
(RefSeq) chlorophyll(ide) b reductase NOL, chloroplastic
  KO
K13606  chlorophyll(ide) b reductase [EC:1.1.1.294]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00860  Porphyrin and chlorophyll metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    111914654
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.294  chlorophyll(ide) b reductase
     111914654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Polysacc_synt_2 F420_oxidored GDP_Man_Dehyd NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 111914654
NCBI-ProteinID: XP_023766120
Position
Unknown
AA seq 348 aa AA seqDB search
MAITATATSSIFNFNCSLSPPPSLSCRPILSSLPHHHLRLPLARKFVFSTTLPCEKPFIS
KPSVCSSSPGKSQPMVPPYNILITGSTKGIGYALAKEFLKAGDNVLICSRSAERVESALQ
TLRTECGVQHVWGTKCDVRDGNDVKNLVKYAQENLQYIDIWINNAGSNAYSYKPLAEASD
EDLIEVVTTNTLGLMICCREAMKMMLNQARGGHIFNIDGAGSDGRPTPRFAAYGATKRSV
VHLTKSLQAELRMQEVSNVVVHNLSPGMVTTDLLMSGANTKQAKFFINVLAEPADEVAKY
LVPNIRSIPMSGSTRPTYIRFLTGLKAYSQIFTRLAFGARRNRYLVED
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcgattactgcaactgctacttcttccatcttcaacttcaactgctccctctcccct
ccaccatcactaagctgtcgtccaattctttcttctcttccccaccaccatctccgccta
cccctcgccagaaaattcgttttttccactactctaccctgcgaaaaacccttcatctca
aaaccttcggtgtgctcctcgtcccctggaaaatctcagccgatggttcctccttacaat
atcttaatcacgggttccactaaaggaataggttatgccttagctaaagagtttctgaaa
gcaggtgataatgtcttaatatgctcaaggtctgctgaaagggtagaatctgctcttcaa
accttaaggacagaatgtggggtccagcacgtgtggggtacaaaatgtgatgttcgtgat
ggaaatgatgtgaaaaatctagtaaaatatgcacaagaaaacctccaatacatagatata
tggattaataatgcgggatcaaatgcatatagctataaacctctagcagaggcttcagat
gaggatcttattgaagttgtcacgacaaacacacttggtttaatgatttgttgccgggag
gcaatgaaaatgatgcttaatcaagcaagaggaggacatatattcaatattgatggagca
ggttctgatggaagaccaacacctagatttgctgcatatggagcaactaaacgtagtgtc
gtacatttgacaaaatcattacaggcggaattacgtatgcaagaagtaagcaatgttgtt
gtccataacttatcgccaggaatggttacaacggatcttctaatgtcaggtgccaacaca
aagcaggcgaagttttttataaatgttttagcagaaccagcagatgaggttgccaagtat
cttgtcccgaatattagatcaataccaatgagtggatcaacaaggccaacttacattcgt
tttcttaccggattaaaagcttactcccaaatttttactagattggcttttggagctaga
agaaatagatacttggttgaagattga

DBGET integrated database retrieval system