KEGG   Lactuca sativa (garden lettuce): 111916439Help
Entry
111916439         CDS       T05352                                 

Definition
(RefSeq) wall-associated receptor kinase-like 6
Organism
lsv  Lactuca sativa (garden lettuce)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr GUB_WAK_bind WAK PIP49_C PIRT
Motif
Other DBs
NCBI-GeneID: 111916439
NCBI-ProteinID: XP_023767904
Position
Unknown
AA seq 940 aa AA seqDB search
MGMGSGMGTGMGMENTKLVLLVIFSAFNHCYKMQAFQFFHLLILISLTTRLIEADYYGTP
PCSPMWCGLVLISYPFGIGRNCSANEWFNIICKSWRPYLSALDNVEVLDIGSNTVIVQMS
VNKGDCKNPIKDSNLLPHTSNGQSPFRISRSLNRFVFKGCGNGAIMENGTIVAGCSTTCG
KDTVSDVSDLYNCFGDGCCQTTIPHDMKSVTFNLTGSEKHNGDRACGSAFLVDSIQYSQD
YNSQTIGKDLAFVPVSLVWNETSLASSCNETCGKIPILYPFGIKRDCSKSDGFNIDCNSS
TPYLSAFNNVEVLGFNSEKKTVTVNFPMVSDCGNPFQNNNLELSTSLFHFSSAENMFVVQ
GCGSAAIMENGTIAGGCSTTCGNNTVSDTNNCFGIGCCQTTISNNLKSFKLNLTGLERQD
GNGTCGSAFLVDRKSFIEKRFSGQFIPIALTWETSASYSESCKSCELHGGVCYISPNGVS
GMACNPKESSNESHTGLILSKDSGSNVKANNNGCMSIRNCVSISIGLLFLTVTSYALYNI
IKKAKMKRRKQRFFKRNGGLLLKQQQATDIGLVDKTILFTSDELDKATDNFNENRILGQG
GQGTVYKGMLPDGRIVAIKKSKVVDECQLEQFINEVVILSQVNHRNVVKLLGCCLETEVP
LLVSEFISNGTLYDLIQNEAGEFACPLNLRLQIAIEVAEAVSYLHSATTIPIYHRDIKTA
NILLDEKYKAKVSDFGTSRVVPIDKTHCTTTVMGTFGYLDPEYYSSSQLTEKSDVYSFGV
VLLELLTGEKAVFLTKDVKTSLVEHFKVAMKEGRGLSIFDKMVLKEGPTSELLAIAKLSL
KCLNLNGKNRPKMKEVAIELEGIRLSYMPSTIQTAFGHVKSNGSTSRSLTSNTELEGNRM
SHVPSTIGTSSGHVKSHEEVSQTHGGSTSTSLTFEDDLCR
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggggatggggtcgggtatggggacggggatggggatggagaacacgaaactcgttttg
cttgttatattttccgctttcaatcattgttacaaaatgcaagcctttcagttttttcac
ttgctcatattgatttcgttaacaacaagattaatagaagctgattattacggaacacca
ccatgcagtccgatgtggtgtggacttgtcctgattagctaccctttcggaattggaaga
aattgttctgccaacgaatggttcaatatcatttgtaaatcttggcgaccgtatctatct
gcacttgacaacgtagaggtgctggacataggctcaaacacagtcattgtccagatgtcc
gtaaataaaggcgattgcaaaaatccaatcaaagatagcaatcttctcccacacaccagc
aatggccaaagtcccttccggatttccagatcgcttaacagattcgtctttaagggatgt
ggcaacggggctatcatggagaatggaactattgtcgcaggttgttcaacgacttgtggc
aaggacactgttagtgacgtcagtgacctttataactgctttggcgatggttgttgccaa
actacaattcctcatgatatgaagtcggttaccttcaatctaacaggatcggaaaagcac
aatggagatagagcttgtgggtccgccttcttggtggatagtatacaatattcacaagac
tataacagccaaactattggtaaggaccttgcttttgttccagtgtcacttgtgtggaac
gaaactagcttagcaagctcatgcaacgagacgtgtgggaagatccctattctctaccct
ttcgggattaaaagagattgttccaagagcgatgggttcaatattgattgtaactcctct
acaccttatttatctgctttcaacaacgtggaggtgttgggttttaactcggagaaaaaa
acagtaactgttaattttcccatggtttctgattgtgggaatccgttccagaataacaat
cttgaactaagcacaagtctttttcatttctccagtgcagaaaacatgtttgtggttcag
ggatgtggcagtgctgccattatggagaatggtactattgcgggtggttgttcaacgact
tgtggcaataacactgttagtgacaccaacaattgctttggcatcggttgttgccaaact
acgatttccaataatctcaagtcatttaagttgaatctaacagggttggaaaggcaggat
ggaaatggaacgtgtgggtctgcctttttggtcgataggaaatcattcattgaaaaaaga
ttttctggccagtttattccgatagctcttacgtgggagacctcagctagttactcagaa
agctgcaaatcgtgtgaactccatggaggggtttgttacataagtcctaatggggtctcg
ggcatggcttgtaatcctaaagaaagcagcaacgaatcacatactggtctcattctaagt
aaggatagcggttctaatgttaaagcgaataacaatggttgcatgtccataagaaactgt
gtgagcataagcatagggttgctattcctaacagtgacgagttatgcgttgtacaatatt
atcaagaaagcgaaaatgaaaagaaggaaacagaggttttttaagcgcaatggaggtcta
cttcttaaacaacaacaagcaaccgatattggtttagttgataaaactatcctttttaca
tccgatgaattggacaaggccacagacaattttaatgagaatagaattcttggtcaagga
ggtcaaggtacagtgtacaaaggcatgttacctgatggacgaattgtagcaatcaagaaa
tcaaaggtagttgatgaatgccaactagaacaattcatcaacgaggtagtcattctttcg
caagtcaaccatagaaatgtggttaaactattgggatgttgcctggaaactgaggtgcca
ttacttgtctctgaattcatatcaaatggtacattgtatgaccttattcaaaatgaagcc
ggtgagttcgcatgccctctaaacctgagattacaaatcgctatagaggttgcagaagcg
gtttcctacttacattcagcaaccaccattcccatataccatagggacatcaagactgcc
aacatacttttggatgaaaagtataaagccaaagtttcagattttggaacatcaagagtt
gtaccaatagataaaactcattgtactacaacagtcatggggacattcggctacttggat
ccagagtattatagctcgagtcagttgactgaaaagagtgatgtctacagttttggagtt
gttttgctagaactcttgaccggagaaaaagctgttttcttaaccaaagatgttaaaaca
agtttagttgaacactttaaggtagccatgaaagaaggacgtgggttgtctatttttgat
aaaatggttctaaaggaggggccgacgagtgagttgttggccatagctaagttgtcattg
aaatgcttgaatttgaatgggaaaaataggccaaaaatgaaagaagttgctatcgagttg
gaaggcattagattgtcatatatgccgtctacaattcaaactgcttttggacatgtaaag
tctaacgggtcaacatcaagatcattaacatccaatactgagttagaaggcaatagaatg
tcacatgtgccttctacaattggaactagttctggacatgtgaaatcccatgaggaagta
tcacaaacacatggtgggtcgacatctacatcattaacatttgaagacgacctttgtcga
tga

DBGET integrated database retrieval system