KEGG   Lactuca sativa (garden lettuce): 111916484Help
Entry
111916484         CDS       T05352                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00350  Tyrosine metabolism
lsv01100  Metabolic pathways
Module
lsv_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111916484
Enzymes [BR:lsv01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     111916484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 111916484
NCBI-ProteinID: XP_023767918
Position
Unknown
AA seq 228 aa AA seqDB search
MTTNSSPGEPKKLQLYSYYRSSCSFRVRIALNLKGLDYEYKAVNLLKGEQQSPEFLMVNP
IGYVPALVDGDIVLADSFAIVMYLEEKYPEHPLLPRDLEKKAINYQAANIVSASIQPLQN
LDVLKYIEEKVGPDAKLPWVQKHISKGFTALEKLLKDHAGKYATGDDVFLADVFLAPQIH
GSIQRFNLDMTAFPLLARLHEAYLQLPAFQDAMPENQPDFPAAQSGSV
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaatagtagtccgggggagccgaagaagctgcagctctattcctattacagg
agctcttgctctttccgtgttcgtatcgctttaaacttgaaaggactggattatgaatac
aaagcggttaatctgcttaaaggagaacagcaaagtcctgagtttttaatggtcaaccct
attgggtatgtgcctgcgttggtggatggtgacatagtacttgctgactcttttgcgatc
gtaatgtaccttgaggagaagtatcctgagcatcctttgttacctcgtgaccttgagaaa
aaggcaattaattaccaggctgcaaatatcgtttccgcgagcatacaacctcttcaaaat
ttagatgttttgaagtacatcgaggaaaaggttggtccggatgcaaagcttccatgggta
cagaagcatatcagtaaaggctttacagcacttgagaagttactaaaagatcatgcggga
aaatatgccacaggagatgatgttttcttggctgatgtatttctggcaccacaaatccat
ggttcaatacaaaggtttaaccttgatatgacagcattccctcttttggctaggctgcat
gaggcatacctgcagctacctgctttccaagatgctatgcctgaaaaccagccagacttc
cctgctgctcaatcaggaagtgtttag

DBGET integrated database retrieval system