KEGG   Lactuca sativa (garden lettuce): 111917144Help
Entry
111917144         CDS       T05352                                 

Definition
(RefSeq) beta-caryophyllene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111917144
Enzymes [BR:lsv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     111917144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth MetRS-N CDC4_D
Motif
Other DBs
NCBI-GeneID: 111917144
NCBI-ProteinID: XP_023768568
Position
Unknown
AA seq 557 aa AA seqDB search
MTSFASPLVRSASIKQDVVIRNTVNFHRSIWGDQFLMYEERKDRECEEQLANELKEEVRK
MLIITTQHRKLLELIDAVQRLGVAYHFEKEIEECLNHIYVSYGHGDLWIHNNDLQGTSLW
FRLLRQQGFNVSSGIFNKYKNSDGSFMESMKDDVQGMLSLYEAAYMRVEGEQVLDEALAF
TTYHLANILENHTSLIEAQIHQALQQPLRKRLPRLEALRYIPIYQQEASHNEPLLKLAKL
DFNLLQDLHRKELSQISKWWKDLDVSRNLPYVRDRIVEGYFWILAVYFEPQHSDARIFLM
KACNLVIILDDTYDNYGTYEELEIFTEAIQRWSMSCLDMLPEYMKLIYKELLDVYKEAED
LLEKKGQTYRCYYMKEMVKEYARNLLIEAKWVNERYTPTVEEHRSVTLVTCAYAMIIAKC
YVHRDDLVTEETFKWVSTYPPLVKASCLILRLMDDVATHKEEQERNHVASSVECYMKQYG
VTEEHTHELFTKQVEDEWKVINKESLRPTDVPRPLLMPPINLSRVCDVLYRRGDDYNHAG
KEMINHIKSLLVNPLSG
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttttgcttccccccttgtacgtagtgcaagtatcaaacaagacgtcgttatc
cgcaacacagtgaacttccatcgtagcatttggggagatcagtttctcatgtatgaagag
agaaaggatcgagaatgcgaggagcaactagccaacgaactgaaagaagaagtgcgcaaa
atgctaattatcaccacacaacataggaagcttttagaacttattgatgcggtccaacgc
cttggtgtagcatatcattttgaaaaagaaatcgaagaatgtctaaatcatatttacgtt
tcgtatggccatggggatctatggatccataataacgatctccaaggaacttcactatgg
ttcagactactacgacaacaaggcttcaatgtttcaagcggaatattcaacaagtacaag
aacagcgacgggagtttcatggagtccatgaaagatgatgttcaaggcatgctttctttg
tacgaagcagcatacatgagggtggaaggggaacaagttttagatgaagcactcgcgttt
acgacctaccatcttgccaacatactcgaaaatcacacttccctgattgaagctcaaata
catcaagccctacaacaacctcttcggaaaaggttgccaaggctagaggcgttacgttat
atacctatctaccaacaggaggcttctcataacgagcctttgctaaaacttgccaagtta
gatttcaatttgctccaggatttgcaccgaaaggagcttagtcaaataagcaaatggtgg
aaggatttggatgtgtcaagaaatctaccttatgttcgagatagaatagttgaaggctac
ttttggatattggcagtctattttgagcctcagcattcagacgccaggatttttctaatg
aaagcatgcaatcttgtaataattttggatgacacgtacgataattatggtacttatgaa
gaactcgagatctttactgaagccattcaaagatggtcgatgagctgcttggatatgctt
ccagagtacatgaaactgatatataaagaacttcttgacgtttataaagaagctgaagat
ttgctagaaaagaagggacagacatatcgttgctactatatgaaagagatggtgaaagag
tacgctcgaaatctcttaattgaagccaaatgggtaaacgagaggtatactccaactgta
gaggaacataggtctgttaccttggtaacttgtgcctacgccatgattatcgcaaaatgt
tatgtgcatagggatgatttggtcaccgaggagacgttcaaatgggtatccacatatcct
cctcttgtcaaagcttcgtgtttgattctaaggctcatggacgatgttgctacacacaag
gaggaacaagaaagaaaccatgtggcttcaagcgtcgaatgctacatgaaacaatacggt
gtcactgaggagcacacacatgaattattcacgaaacaagtcgaagatgagtggaaagtc
ataaataaagagtcgctaaggccgaccgatgtcccgaggcctctacttatgcctccgatc
aacctctctcgtgtttgtgatgttctttatagacgaggtgatgattacaatcatgctgga
aaagaaatgatcaaccacattaaatcacttcttgttaatcccttaagtgggtag

DBGET integrated database retrieval system