KEGG   Lactuca sativa (garden lettuce): 111917553Help
Entry
111917553         CDS       T05352                                 

Definition
(RefSeq) heat shock 70 kDa protein cognate 1-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03040  Spliceosome
lsv04141  Protein processing in endoplasmic reticulum
lsv04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111917553
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111917553
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111917553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lsv01009]
    111917553
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:lsv03041]
    111917553
   03009 Ribosome biogenesis [BR:lsv03009]
    111917553
   03110 Chaperones and folding catalysts [BR:lsv03110]
    111917553
   04131 Membrane trafficking [BR:lsv04131]
    111917553
   03051 Proteasome [BR:lsv03051]
    111917553
   03029 Mitochondrial biogenesis [BR:lsv03029]
    111917553
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lsv04147]
    111917553
Protein phosphatases and associated proteins [BR:lsv01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111917553
Spliceosome [BR:lsv03041]
 Complex B
  Other components
   Prp19 complex
    111917553
 Complex C
   Prp19-CDC5 complex
    111917553
Ribosome biogenesis [BR:lsv03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111917553
Chaperones and folding catalysts [BR:lsv03110]
 Heat shock proteins
  HSP70 / DNAK
   111917553
Membrane trafficking [BR:lsv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111917553
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111917553
Proteasome [BR:lsv03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111917553
Mitochondrial biogenesis [BR:lsv03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111917553
Exosome [BR:lsv04147]
 Exosomal proteins
  Proteins found in most exosomes
   111917553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 FtsA
Motif
Other DBs
NCBI-GeneID: 111917553
NCBI-ProteinID: XP_023768993
Position
Unknown
AA seq 105 aa AA seqDB search
MSSEGDGAPAIGIDLGTTNSCVAVWKHNRIEILPNDQGNRTTASCVAFTNAERLVGDGAK
NQIAKNPANTVFDVKRLIGRRFSEVTVQEDIKLLPFKVIKGSSIF
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtgagggagatggagcaccggcaatcggaatcgatttgggcacaacgaactca
tgtgttgctgtttggaaacacaacagaatcgagatcttacccaatgaccaaggcaaccga
acgacggcgtcttgtgttgctttcactaatgctgaacggctcgttggtgatggtgccaag
aatcaaattgcaaagaacccagcaaacactgtattcgatgtgaagaggctgatcgggagg
aggtttagtgaagtaacagtgcaggaagacataaagttgttgccatttaaggtcataaaa
gggtctagcatcttctga

DBGET integrated database retrieval system