KEGG   Lactuca sativa (garden lettuce): 111917732Help
Entry
111917732         CDS       T05352                                 

Definition
(RefSeq) histidine kinase 4-like
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    111917732
Enzymes [BR:lsv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     111917732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA
Motif
Other DBs
NCBI-GeneID: 111917732
NCBI-ProteinID: XP_023769164
Position
Unknown
AA seq 943 aa AA seqDB search
MGVKMQGHHHLVAVSLNEQQLGTKRKYKSYIPRTNQRKYLALWIISFGFVAIYVYKCIDA
GHQERIEEGLVSMCDQRARMLQDQFRVSVNHVHALAVLVSTFHYYKNPSVIDQETFAEYT
ARTAFERPLLSGVAYAQRVMNYEREELERQHDGTIRTMTKEPSPFRDEYAPVIFAQETVS
YLKLVDMMSGEEDRENILRARATGKAVLTSPFKLLGSNHLGVVLTFPVYKSKLPPNASVQ
ERIAATAGYLGGAFDVESLVENLLGQLAENQEIVVKVFDVTNTSNPLITYGRQTEDGDMS
HTRVSMLDFGDPFRKHQMTCRYLHKAPISLTAFATATLGYVIVILAGYMFYTGAIHIVQV
EDDFDTMQQLKVRAEAADVAKSQFLATVSHEIRTPMNGILGMLALLLDTELSSTQRDYAQ
TAQACGRALIALINEVLDRAKIEAGKLDLESVPFDIRSILDDVLSLFSEKSRHKGIEMAV
LVSDKVPQIVIGDPGRFRQVITNLVGNSVKFTEKGHIFVQVHHADHSKAVVMDMAKSNGC
GSHFKTLSGCEAADDRNNWDTVKQLAAPIENVVNLIVSVEDTGIGIPAHAQDLVFMPFMQ
ADSSTSRLYGGTGIGLSISKCLVELMGGQISFVSRPQIGSTFSFTVALKTCKNGDVKKSL
YNDDLPNSFQGLKVTLVDSKPIRAAVTRYHLQRLGIIVKIIDTIKTAEDLGDSKPDLLLI
EKDTWLLNESMIKIQNFPKKMVLATNITTPEFDKLKSAGFSDTVIRKPLRASMVAACLQQ
VLGTGQKAETRAKGSFYLRGLLCGKKILVVDDNRVNRRVAAGALKKFGAAVECAESGVAA
LALLQLPHAFDACFMDIQMPEMDGFEVTRRIRMMEREANEVVGSIEWHLPILAMTADVIH
ATFEECKRSGMDGYVSKPFEEENLYQAVAKFFESKTGEHTQNG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtaaaaatgcaaggccaccatcacttagtagcagtgagtttgaatgaacagcaa
ttgggcacaaaaaggaagtacaaatcatacatcccaagaacaaatcaacgaaaatactta
gcgttatggatcatttcttttggatttgtcgcgatttatgtttacaaatgcatagatgca
gggcatcaagagagaatcgaagagggtttagtgagtatgtgtgatcaaagggcaagaatg
ttgcaagatcaatttagggttagtgtaaatcatgtacatgctctcgctgttctggtgtcg
acttttcattattacaagaacccatcagtaatcgatcaggaaacatttgcagaatacaca
gcaagaacagcattcgagcgacctttgttgagtggagttgcatatgcacaaagggtaatg
aattacgagagagaagaactcgagagacaacatgatgggaccataagaacaatgaccaaa
gagccctcgccgtttcgtgacgaatatgcccctgtaattttcgctcaagaaaccgtttcc
tatcttaaattggtagatatgatgtctggcgaggaggacagagagaacatattgagggct
agagcaactgggaaagcagtgctcacaagccctttcaaacttcttggttctaatcatcta
ggggtagttttgacatttcctgtgtacaaatcaaagcttccaccaaacgcatctgttcaa
gaacgcatcgcagctactgccggatatctaggtggagcttttgatgttgagtcactagta
gaaaatttactagggcaacttgctgaaaatcaagaaattgttgtaaaagtttttgatgtc
acaaatacatcaaatccattgatcacatatgggcgtcaaactgaagatggtgacatgtca
cacacacgagtgagtatgcttgattttggtgatccgtttaggaagcatcaaatgacttgt
agatatcttcataaagcaccgatatcattaacagcatttgcaactgcgactttaggttat
gtgattgtgatattagctggctacatgttttacacgggagccattcatattgttcaggtt
gaagatgattttgacacgatgcaacaattaaaagttcgagcagaagctgctgatgttgct
aaatcacagtttcttgcgactgtttcccatgaaatcagaacccccatgaatggcatcctt
gggatgcttgcattgcttctagatacagaattaagttcaacccaaagagattacgctcaa
actgcacaagcttgtggaagagcattaatcgcattgatcaatgaggtcctcgatcgagcc
aaaattgaagccggaaaattagacctagaatccgtcccctttgatatccgctccattctc
gacgatgttctctctttattttctgaaaaatctcgacacaaaggaatcgagatggcagtt
cttgtttccgataaagtcccacaaattgtcatcggagatccgggaagattccgacaagtc
atcacgaatctcgtcggaaactctgttaagttcacagaaaaaggacatatattcgttcaa
gttcatcacgccgatcattccaaagctgtagtaatggacatggctaaatcgaacgggtgt
gggtcccatttcaaaactttaagcggctgtgaagccgccgatgatcgaaacaattgggac
actgttaaacaattagcagccccaattgaaaacgttgttaacctaattgtctccgttgaa
gacaccggaattgggattccggcgcacgcacaagatctcgtttttatgccgttcatgcaa
gccgacagttccacttctagactctacggcggaaccggaatcggattgagtatcagtaaa
tgtttggttgaattaatgggtggtcagataagcttcgttagccgaccacaaatcggaagc
acgttttctttcactgtcgctttaaaaacctgcaaaaatggcgatgtgaaaaaatccctt
tacaatgacgatcttccgaattcctttcaaggattgaaagtaaccttggtcgattcaaaa
ccaatcagagctgcagtgacacgataccatttacagagactcggtataatcgttaaaatt
attgataccataaaaacggcggaggatttgggagattcaaaaccggatctacttctaatc
gagaaagacacatggttattaaacgaaagcatgatcaaaattcaaaatttccctaaaaag
atggttctagcaacaaatataacgactcccgaattcgataaattaaaatccgccgggttt
tccgatactgtgattaggaagccgttaagagcgagcatggtggcagcttgtttgcagcag
gttttgggaacagggcagaaggccgaaaccagggcaaaagggtctttttatcttcgaggg
ttactttgtgggaagaaaattttggtggttgatgataacagagtaaaccggagagttgcc
gccggtgccctaaaaaaatttggggctgcggttgagtgtgccgaaagcggtgttgccgcc
cttgctctacttcagctaccacatgcttttgatgcttgcttcatggatattcaaatgccc
gaaatggacggttttgaggtgacgcggcgtatacggatgatggaaagggaggcgaatgag
gtagtagggagtattgaatggcatttgccgatactggcgatgacagcggatgtgattcat
gcgacgtttgaagagtgtaagagaagtggaatggatgggtacgtatcgaagccttttgag
gaagaaaatctttaccaggctgtggcaaagttttttgaatccaaaaccggcgaacacaca
caaaatggctaa

DBGET integrated database retrieval system