KEGG   Lactuca sativa (garden lettuce): 111918965Help
Entry
111918965         CDS       T05352                                 

Definition
(RefSeq) alcohol dehydrogenase 2-like
  KO
K18857  alcohol dehydrogenase class-P [EC:1.1.1.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00010  Glycolysis / Gluconeogenesis
lsv00071  Fatty acid degradation
lsv00350  Tyrosine metabolism
lsv00592  alpha-Linolenic acid metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    111918965
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111918965
   00592 alpha-Linolenic acid metabolism
    111918965
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    111918965
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     111918965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N
Motif
Other DBs
NCBI-GeneID: 111918965
NCBI-ProteinID: XP_023770349
Position
Unknown
AA seq 86 aa AA seqDB search
MPSTTNQVIRCKAAVAWEAGKPLVIEEVEVAPPQKMEVRIKILFTSLCHTDVYFWEAKGQ
NPVFPRILGHEAGGVVESVGEGVTDL
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcactactaaccaggtgattcgatgcaaagcggcggtggcatgggaagccgga
aagccactggtgattgaagaagtggaggtggcgccaccccagaaaatggaagttcgaatc
aaaatcctcttcacctccctgtgccacaccgatgtttacttctgggaagccaagggtcag
aatcccgtgtttcctcgaattttaggacatgaagctggaggggttgtggagagtgttggg
gaaggtgtgactgatctt

DBGET integrated database retrieval system