KEGG   Lactuca sativa (garden lettuce): 111921056Help
Entry
111921056         CDS       T05352                                 

Definition
(RefSeq) monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00740  Riboflavin metabolism
lsv00790  Folate biosynthesis
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
Module
lsv_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    111921056
   00790 Folate biosynthesis
    111921056
Enzymes [BR:lsv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     111921056
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     111921056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_cyclohydro2 DHBP_synthase
Motif
Other DBs
NCBI-GeneID: 111921056
NCBI-ProteinID: XP_023772415
Position
Unknown
AA seq 528 aa AA seqDB search
MDSVIFYHPLFPPFTTTTRHTSTYAPPKPPPLSAHKTLTFTCWALGNDDGGSENGLGFGV
SASDAGELFPTPEISDAFMTVDAEITPDTVNFFVSDAEGDPDCPSDGFSSVEDALTTLRE
GKFVIVVDDENGDIEGNFVLAASFATPETIGFVIRHGSGIISVGMTTNDLERLNLPLMSP
ENEHKSSAPSFTITVDAIDTATGVSASDRAKTILALASRSSGPESFRRPGHVFPLKYRNG
GVLRRSGHTEASVDLVKLAGLDPVSVLSTIVNPEDGSIAQLNRLQKLALDHNIPLVLITD
LIRYRRKRERLVERVAISRLPTKWGLFEAYCYRSKLDGTEHIAIVKGDIGNGHDVLVRVH
SECLTGDIFGSGRCDCGKQLELAMQIIEESGRGALIYLRGHEGRGIGLGHKLKAYNLQDQ
GHDTVEANLELGFAPDAREYGIGAQMLRDIGVQTMQLMTNNPAKFTGLKGYGLAIVGRVP
VLTPITDENRRYFETKRTKMGHIYGSDIPLISPKTYKNDSSDVSDTKL
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggattccgtcatcttctaccacccactattcccaccattcaccaccaccacaagacac
acatcaacctacgcacctcccaagccaccaccgctttccgcccacaagacactcactttc
acttgctgggcactcgggaacgacgacggcggcagtgagaacggtttgggtttcggtgtt
tcagcttcagacgccggagaactgttccctacgccggaaatttcagacgcttttatgaca
gtcgatgctgagataacccctgacaccgttaatttctttgttagcgatgccgagggtgat
cccgattgcccctccgacggcttctcctccgtcgaggacgctcttaccactctccgggaa
ggaaagtttgtgatcgttgtcgacgacgaaaatggcgatatcgaaggaaacttcgtcttg
gcagcatcatttgcaactccagaaaccatcggattcgtgatcagacacggctccgggatc
atctccgtcggcatgacaactaacgatctcgaaagattaaacctccctctaatgtcaccg
gaaaacgaacacaaatcttcagcaccatcattcacaatcacagtggacgcaatcgacaca
gcaaccggagtatctgcttccgatagagcaaaaacgattcttgctttagcatcccgttcc
tccggccctgaaagtttcagaagacccggccatgtgtttccattaaagtaccgaaacggc
ggtgttctccgacgatcagggcacacggaggcgtccgttgatcttgtcaaactcgctggt
ttggatccagtttctgttctttcaaccatcgtgaatccagaagatggttctatcgcccaa
ttgaatcgcttacaaaaactagcacttgatcacaacatccctcttgttctgatcaccgat
ttgatcaggtatagaaggaagagggaaagattagttgaaagagttgcgatttctaggcta
ccaacgaagtggggtttgtttgaagcttattgttatcgatcaaaactagatggaacagag
catatagccatagtcaagggcgacattggaaacgggcacgatgtgttagtacgggttcac
tcagaatgtttgaccggggacatatttgggtcgggtcggtgtgattgtgggaaacaattg
gaattggccatgcagataattgaggaatcgggtcgaggagccctaatttatcttcgggga
catgaaggaagaggtatcgggttgggacataagttaaaagcgtataatttgcaagatcaa
ggtcatgatactgtagaagcgaatctcgagctcggttttgctcccgatgcacgagaatat
ggaatcggcgctcagatgttaagagacattggagttcagacaatgcagctaatgactaat
aatccggccaagtttactggtctcaagggttacggtttggcaattgttggtcgagttcca
gtattgacaccgattacagatgaaaatagaaggtactttgaaacaaaaagaacaaagatg
ggtcatatatatggatctgatatccctttaattagtccgaaaacatataaaaatgactca
tcagatgtgtcagatacaaagttatga

DBGET integrated database retrieval system