KEGG   Lachancea thermotolerans: KLTH0B03916gHelp
Entry
KLTH0B03916g      CDS       T01117                                 

Definition
(RefSeq) KLTH0B03916p
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
lth  Lachancea thermotolerans
Pathway
lth00730  Thiamine metabolism
lth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KLTH0B03916g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     KLTH0B03916g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thi4 DAO NAD_binding_8 FAD_binding_2 NAD_binding_9 Lycopene_cycl Pyr_redox_2 FAD_oxidored Pyr_redox_3 HI0933_like GIDA Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 8290793
NCBI-ProteinID: XP_002551959
UniProt: C5DCL0
Position
B:320151..321128
Genome map
AA seq 325 aa AA seqDB search
MSTTTTNTETAQLQVSAGTIRHALSDVVKQEDWSDFQFAPIRESTVSRAMTSRYFQDMDK
FAVSDVVIVGAGSSGLSAAYVIAKNRPDLKVACVESNVAPGGGAWLGGQLFSAMIMRKPA
HLFLDELELPYEDEGDYVVVKHAALFTSTVLSKVLLFPNFKLFNATAVEDLVTRPADDNT
GGVSVAGVVTNWTLVSMAHDLQSCMDPNVIELSGYQNDGTRDPSKKHGVILSTTGHDGPF
GAFSAKRIVSIDKNKKLGGMKGLDMNRAEAGVVKGAGAYSGVANMYFAGMEVAELEGCNR
MGPTFGAMAVSGIKAAEEILRHFAE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccaccaccaccaacaccgaaaccgctcaattgcaggtgtctgccggcacaatc
agacacgccctgtctgacgttgtcaagcaagaggactggtccgacttccagttcgcgcca
atccgcgagtctactgtgtcacgtgccatgacctcgcgctacttccaggacatggacaag
ttcgccgtgagcgacgttgtcattgtgggcgccggctcctcgggtctgtctgccgcgtac
gttatcgccaagaacagaccagacctgaaggttgcctgcgtggagtccaatgttgcgcca
ggtggcggcgcatggctcggtggccagctgttcagcgcgatgatcatgagaaagcccgcg
cacctatttttggacgagctggagctgccatacgaggacgagggtgactacgtggtcgtc
aagcacgcggctctattcacctcgaccgtgttgagcaaggtgctactattccctaacttc
aagctgttcaacgcgactgccgtggaggacttggtcacgagacctgccgacgacaacacc
ggcggcgtgagcgtcgctggtgtggtgaccaactggaccttggtgtcgatggcgcacgac
ctacagagctgcatggaccctaacgttatcgagctgagcggctaccagaacgacggcacc
cgcgaccctagcaagaagcacggtgtcatcttgtcaaccacaggtcacgacggtccattc
ggcgcgttctccgccaagagaattgtgtcgatcgacaagaacaagaagctgggcggaatg
aagggtctggacatgaaccgtgctgaggccggtgtggtcaaaggcgctggcgcttactcc
ggagtcgcaaacatgtactttgccggtatggaagtggccgagctggagggctgcaacaga
atgggtccaaccttcggtgccatggctgtcagcggtatcaaggctgctgaggaaatcttg
agacactttgccgaataa

DBGET integrated database retrieval system