KEGG   Lachancea thermotolerans: KLTH0C02552gHelp
Entry
KLTH0C02552g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C02552p
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
lth  Lachancea thermotolerans
Pathway
lth03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:lth00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    KLTH0C02552g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:lth03021]
    KLTH0C02552g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     KLTH0C02552g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TFIIS_C RNA_POL_M_15KD DZR Zn_Tnp_IS1595 zinc_ribbon_2 Mu-like_Com TF_Zn_Ribbon zf-RRN7 GATA Zn-ribbon_8 IBR C1_1 eIF-5_eIF-2B Ogr_Delta TackOD1 OrfB_Zn_ribbon zf-C4_Topoisom Lar_restr_allev DUF2072 zf-TFIIB Baculo_p48 Baculo_LEF5_C zf-ZPR1 zf-H2C2_2 DUF3797
Motif
Other DBs
NCBI-GeneID: 8291199
NCBI-ProteinID: XP_002552339
UniProt: C5DDP0
Position
C:complement(228167..228544)
Genome map
AA seq 125 aa AA seqDB search
MSVVGSLIFCAECGNLLDNPSAVEGAQLECAQCGAEYAKAKFSNLRVVTSTADDAFPSAL
RSKKSVVKTSLKKDELEEGATIREKCPQCGNDEMHYHTLQLRSADEGATVFYTCTSCGYR
FRTNN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtagtcggttccctgatattctgcgccgagtgcggtaaccttctcgacaacccc
tccgccgtcgagggcgcccagctcgagtgcgcccagtgcggcgccgagtacgccaaggca
aagttctccaacttgcgcgtcgtcacctccaccgccgacgacgcgttcccctccgcgctg
cgctccaaaaagtccgtcgtcaagacctctctcaagaaagacgagctcgaggagggcgcc
accatccgcgaaaagtgcccgcagtgcggcaacgacgagatgcattaccacaccctccag
ctgcggtccgccgacgaaggtgccaccgtcttctacacctgcacctcctgcggctaccgc
ttccgtaccaacaactga

DBGET integrated database retrieval system