KEGG   Lachancea thermotolerans: KLTH0C03168gHelp
Entry
KLTH0C03168g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C03168p
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lth  Lachancea thermotolerans
Pathway
lth00260  Glycine, serine and threonine metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0C03168g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KLTH0C03168g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 8291227
NCBI-ProteinID: XP_002552363
UniProt: C5DDR4
Position
C:complement(275449..276714)
Genome map
AA seq 421 aa AA seqDB search
MALAYIRLATAGHRRPAQHAGVSATHTHLHLLLLHSMSDLPEPYTSAENDFRSDTFTTPT
AEMMQAACSASIGDAVYNEDLDTLALERQVAQLAGKPAGLFCVSGTLSNQIALRAHLYQP
PYSVLCDYRAHVYTHEAAGLAILSQAMVTPVVPSNGNYLTLEDIRRAYIADDGDIHGAPT
RVVSLENTLHGIVHPVDELVRIKAWCVENQIRLHCDGARLWNAVIESGVPMKQFGEIFDS
ISICLSKSLGAPMGSVLVGDAKFIKKCNHFRKQQGGGVRQSGMMCRMASVAVQGDWRAHL
ARSHRMAHELAAFCATHGIPLESPADTNFVFIDLRRARMDPDVLVKKGLKYHVKLMGGRV
SFHYQISDASLERVKIALLEAFQHAQEHPFDTDGPTKIYRSESTEVDIEGNAIGELQTYK
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcgcctatataaggctagccactgcaggccatcggcgcccggcgcagcacgcg
ggagtttccgcgacgcatacacacctccacctcctcctcctccattccatgtcagacctc
cctgaaccctacacctccgcggaaaacgacttccgctcggacacatttaccacgccgacg
gccgaaatgatgcaggccgcgtgctcggcatcgatcggtgacgccgtgtacaacgaggac
ctcgacacgctagcgctcgagcgccaggtggcgcagctggccggcaagcccgccgggctg
ttctgcgtgtccggaacgctgtctaaccagatcgcgctgcgtgcgcacttgtaccagccg
ccgtactcggtgctgtgcgactaccgcgctcacgtgtacacgcacgaggccgccgggctg
gcgattctgtcgcaggccatggtgacgccggtcgtgccgtcgaacggcaactacctgacg
ctggaagacatccgccgcgcgtacatcgcggacgacggcgacatccacggcgcgcccacg
cgcgtggtgtcactggagaacacactgcacgggatcgtgcaccccgtggacgagctggtg
cgcatcaaggcgtggtgcgtggagaaccagatccgcctgcattgcgacggtgcgcggctg
tggaacgcggtgatcgagtccggcgtgcccatgaagcagttcggcgaaatcttcgactcg
atttccatctgcctgtccaagtcgttgggtgcgcccatgggctctgtgctggtcggtgac
gccaagttcatcaagaagtgcaaccacttccgcaagcaacagggcggtggtgtgcggcag
agcgggatgatgtgccggatggccagcgtcgccgtgcagggtgactggcgcgcgcacctg
gcgcgctcccaccgcatggcgcacgagctggccgcgttctgcgcgacccacggcatcccg
ctggagtctcccgcggacaccaacttcgtgttcatcgacctgcggcgcgcgcgcatggac
cccgacgtgctcgtcaagaagggcctgaaataccacgtcaagctgatgggcggccgtgtg
tcgttccactaccagatctccgacgcctcgctggagcgcgtgaagatcgcgctgctggag
gccttccagcacgcgcaagagcatccattcgacaccgatggccccaccaagatttaccgc
agcgagagcaccgaggtggacatcgagggcaacgcgattggcgagctgcagacctacaag
tactga

DBGET integrated database retrieval system