KEGG   Lachancea thermotolerans: KLTH0C07304gHelp
Entry
KLTH0C07304g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C07304p
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
lth  Lachancea thermotolerans
Pathway
lth00280  Valine, leucine and isoleucine degradation
lth00410  beta-Alanine metabolism
lth00640  Propanoate metabolism
lth01100  Metabolic pathways
lth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KLTH0C07304g
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KLTH0C07304g
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KLTH0C07304g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     KLTH0C07304g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 8291412
NCBI-ProteinID: XP_002552543
UniProt: C5DE94
Position
C:632098..633528
Genome map
AA seq 476 aa AA seqDB search
MLRSSLRCHQIKRFMSEQVKFGSKGVSRVVTLSRPEKLNALSDQMCRKMIPTLQEYAKSE
TNNIVVIGSANAPRSLCSGGDVATVALQNIAGKRDLSLEFFRNEYSLNLLLATYNKPVVV
LMDGITMGGGVGLATHVPFRIATENTRWCMPEMDIGFFPDVGTTFSLPQLTTVGGTKGQL
ALYLCLTGDLLSGIDVYMAGLASHYVPSHNLVDLQARLGELPVTNSEEMWQITGNAIEEF
SVGIPEDYNFKYSNAQLDVIESCFDIGHGWKGINTALEKVVNSSSASPEEKEFARLTLQK
LGTKSPVSVQVAIEQFRRNSQTDVESALKQDLVTASNMCEDPASEFSQATKHKLVDKSKS
AFPWTKTSLTLEELSRLVSPRASASVSLQKFDKAVTWKKYPYHSQFMLPTEQNFKDYITG
NDNSGRSLAANQAEVVKYFSQYNSSSKGKTGIEYLCNLVCSRKCTVGDAGELRWNN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggtcatcactcaggtgccatcagatcaagaggttcatgtctgagcaggtaaag
ttcggatccaagggcgtttcacgcgtggtaacgctgtcgaggcctgaaaagctcaatgcg
ctctctgaccagatgtgccggaagatgataccgacccttcaagagtatgcgaaaagcgaa
acaaacaacattgtggtcatcggctctgcaaacgctcccaggtcgctgtgttctggagga
gacgtggctaccgtcgccttgcagaatatcgcggggaagcgcgacctctcgcttgagttt
ttccgcaatgaatactccttaaacctgctcttggcaacttacaacaagccagtggtcgta
ttgatggatggtatcactatgggcggaggcgttggcttggccacacatgtaccgttccgg
attgcgaccgagaacactcgttggtgcatgcctgaaatggacatcggattctttcctgac
gtcggtactacgttctcacttcctcaactaacaactgttggaggcaccaaaggccagcta
gcgctttatttatgcctcacaggcgatcttttgagcggcatcgacgtgtacatggctggg
ttagcgtctcattatgtgccaagtcacaaccttgtggatctccaggcgagactgggagag
cttccggtcaccaactccgaggaaatgtggcaaataacaggcaatgccattgaggagttt
tctgttggcattcctgaggactacaacttcaagtactctaatgcccagctagacgtgatt
gaaagttgctttgatattgggcatggttggaagggaattaacactgcccttgagaaggtt
gtgaactccagctctgcgtcgcccgaagaaaaggaattcgcgcgcttaactttgcagaaa
cttggtacaaagagccccgtttcagtccaggttgctattgagcagttccgcagaaattct
cagacagatgtcgagtctgccttgaagcaagacctggtcacagcttctaatatgtgcgag
gacccagcttccgaattctcccaggctactaagcacaaacttgttgataagagcaaatct
gcatttccttggacaaaaacatctttgacccttgaagagctctcacgtttagtatctccc
cgtgcatccgcatctgtgtcactccagaagtttgacaaggcagtcacctggaagaagtac
ccctaccactctcaatttatgcttccaactgagcaaaacttcaaagactatatcacagga
aatgataattctggaaggtcactagctgcgaaccaggcggaagttgtgaagtacttctcg
cagtataactcatcctccaaaggaaagacggggattgaatatttgtgcaacctggtctgc
tccaggaaatgtactgttggtgatgctggtgagctgcgctggaacaactaa

DBGET integrated database retrieval system