KEGG   Lachancea thermotolerans: KLTH0C09306g
Entry
KLTH0C09306g      CDS       T01117                                 

Definition
(RefSeq) KLTH0C09306p
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lth  Lachancea thermotolerans
Pathway
lth00100  Steroid biosynthesis
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
Module
lth_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    KLTH0C09306g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     KLTH0C09306g
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 8291503
NCBI-ProteinID: XP_002552625
UniProt: C5DEH6
Position
C:complement(773612..774934)
AA seq 440 aa
MAKSNAPLNPRTTSFEFSGIPGALGITFGLPLVCVVLNQMIRPDYHITGFFSNFDVAELW
NHIKPLKWYMTNRELWTYYLCWFGSLAILDVVLPGPVMEGVELRDGTKLRYKINGIALCS
LLSSVLAVRWKLTGGQLPELQYLYEHQTDFCIIVVIFSFIMSVFLYMASFFPLTGENGTG
TKERILSVSGNTGNVIYDWFIGRELNPRVGPLDLKMFCELRPGLLLWCLINISCLHHYYL
ETGKINNAILFVTLAQGFYVFDGVLNEEGVLTMMDITTDGFGYMLTFGDLALVPFTYTLQ
ARYLTVSPITLTKGYLAFLTGIMALGYYIFHSANKQKSDFRHGKLPHLESMDTKRGTKLL
CDGWWGMSQHMNYFGDWLISLSWCLATGFQTPLTYYYSLYFATLLFHRQQRDEHLCKIKY
GDDWKRYEEKVPYKIIPYVY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgaaatctaatgcgcctcttaatcccagaactacgagtttcgagttcagcgggatt
cccggagccttgggcatcacgtttggccttccacttgtgtgcgtcgtgctcaaccaaatg
atacgtccagactaccatatcaccggcttcttttcgaactttgatgtggcagagctatgg
aaccatattaaacccctgaagtggtacatgacaaatagagagttgtggacttattattta
tgttggtttggttccttagccatcctcgacgttgttctacctggacctgttatggagggc
gtggagttgagagatggtacaaagctgaggtacaagatcaacggaatcgccctttgctcc
ttgctttcatcggttctggccgtgagatggaagctaaccgggggccagttgcccgagcta
caatacctatatgagcaccagactgatttctgcatcattgtcgttatcttctcgtttatc
atgtcagtttttctctacatggccagcttcttcccattgactggcgagaacggcactgga
acaaaagagcgcatactttcggtgagtggcaacaccggtaatgtgatttacgattggttc
atcggccgcgagttgaaccctcgtgtggggcctctggaccttaaaatgttctgtgagttg
cgcccaggtttgctgctatggtgtttgataaacatctcctgcttgcatcactattatttg
gagactggcaaaatcaacaatgccatcctgtttgtaacattggcccaaggattctatgtc
ttcgacggtgtactgaacgaagagggtgtgcttaccatgatggacatcaccacggatgga
ttcggttacatgttgacgtttggagacttggcgctagttcctttcacttacaccttgcaa
gctagatatctcaccgtctctcccataactttgaccaaggggtacctggctttcttaacg
ggaatcatggcacttggctactacattttccattctgcaaataaacagaaatccgacttc
cgtcacggcaaactcccacacttggaaagcatggacaccaagcgcggcaccaagcttctc
tgtgatggctggtggggcatgtcacaacatatgaactattttggagactggctgatttct
ctaagttggtgcttggcgacggggttccaaactcctctgacctattactactcgctctac
tttgccacgttgttgttccaccgtcaacagcgtgacgaacatctgtgcaagatcaaatat
ggtgacgattggaagaggtacgaggaaaaggtcccttacaaaatcatcccttatgtatac
tag

DBGET integrated database retrieval system