KEGG   Lachancea thermotolerans: KLTH0D00616gHelp
Entry
KLTH0D00616g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D00616p
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lth  Lachancea thermotolerans
Pathway
lth00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KLTH0D00616g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KLTH0D00616g
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KLTH0D00616g
    1.1.1.-  
     KLTH0D00616g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 Pyr_redox_3 Hexapep ADH_zinc_N_2 DUF5420
Motif
Other DBs
NCBI-GeneID: 8294970
NCBI-ProteinID: XP_002552750
UniProt: C5DFX0
Position
D:59883..61031
Genome map
AA seq 382 aa AA seqDB search
MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH
AMSGQGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHEREGLC
IACKTGNPNCCTDLGFCGLGCQSGGFAEKIVLSERNVVKIPNSLPLDVAALVEPISVSWH
AVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEPADTRRQKAEALGAQTFNP
TEHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSAGLHTLTPKGVAVNIAVWGPKPIDF
YPMDVTTSERFVTGSICYTTQDFEEVVDAMDKGKIDINKVKTMITGRERIENGFENGIMD
LINNKEKNIKILLTPNNFKELA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgttagcatactttggtcaaaaagacatccgcttcactgacagccttgcgcaa
ccacaggtttctcatgaggatgaggtggaaattgacgttagctggtgcggtgtatgtggt
tccgatctccacgaatatcttgatggccctattttctttccagctaatgggaagacacac
gctatgagcggccaaggccttccccaggccatgggccatgagatgtctggcattgtgtca
aaagtaggaagcgacgtttccaaggtcaaggttggtgatcacgtggttgtaggtgcatgc
tgcacgtgtgaagaccgcgctaggtggcccgacgtcaagcacgagagggagggtctgtgc
attgcatgcaagacaggaaaccctaactgctgcactgaccttggattctgtgggcttggg
tgccaaagtggcggttttgctgaaaaaattgtcctcagcgagcgtaatgtcgtcaaaatt
ccaaacagtcttcccctcgatgtggccgcacttgtagaacctatctctgtctcttggcac
gcggtccgcatttcgaagctacaaccaggtcagaccgctttggttttgggtgctggcccc
atcggcctagcggcagttcttgcactgcagagccatggtgccggcaccattattgtctca
gaacctgcagacactagaaggcagaaagctgaggctttgggtgctcaaacattcaatcca
acagaacatggtgataacgtcatcgaagcgcttcgtaaattggctccaggcggtgaaggt
ttcaacttctcctacgactgctgtggtaccagcgagactttcagcgccggcctgcataca
ctaacacctaaaggtgtcgctgtcaacatcgcggtttggggtcctaagccaattgacttc
tacccaatggatgtcacaacatcagagagatttgttacaggatccatctgctacactact
caagatttcgaagaggtcgtagacgcaatggacaagggcaaaattgacatcaacaaggtg
aaaaccatgatcacaggtcgcgaaagaattgaaaatggtttcgagaacggcataatggat
ttgatcaacaataaggagaagaacatcaaaattttattgactccgaacaatttcaaggaa
cttgcttag

DBGET integrated database retrieval system