KEGG   Lachancea thermotolerans: KLTH0D08272gHelp
Entry
KLTH0D08272g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D08272p
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0D08272g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     KLTH0D08272g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 8295306
NCBI-ProteinID: XP_002553070
UniProt: C5DGU0
Position
D:complement(695296..696987)
Genome map
AA seq 563 aa AA seqDB search
MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG
YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG
DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL
LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF
PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS
YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP
RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG
ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI
HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML
EVMDAPSSLVRQAQLTAATNAQN
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaatcaccctaggccgctacttgttcgagaggctaagacaagtggaatgtttc
actatttttggcttgcccggagacttcaacctgaggctgctggacgagatctacgaggtc
gagggcatgcgctgggccggcaacacaaacgaactgaacgccgcgtacgcggctgacgga
tacgcacggctcaagggcattgcatgtctaattaccacgtttggggtcggcgaactatcg
gcactcaatggtgtcgtgggctcatacgctgagcacgtaggcgtgctgcacgttgtgggc
gttccctcgctcgcatcgcaggccaagcagcagctgctacaccacacactcggcgatggc
gacttcgcggtcttccaccgcatgtcggccaacatttcgcagaccaccgccatggtcacg
gacctggccaccgcgccgcaggagatcgaccgctgcatccgaaccacctacgtgacgcag
cgccccgtatacctggggctgccggcaaacatagtcaaccagatggttgatcgccgccta
ctcgacacgcccattgacctctcgctcgagcccaacgacgaggacaccgaggaggaggtg
ctcactcaggtgctcgcccttgtccagaaggcgcagaaccccatcatcctcgcggacgcg
tgctgctcgcgccacgacgccaagaaagaggcctggcagctcaccgacgctacgcagttc
ccctgcttcgtcacgcccatgggcaagggctccgttcccgagaaacacccacgcttcggt
ggcgtctatgtcggtacactgtcttcgcccgacgtcaagagcgccgtggaggctgcagat
ctcatcctctcgctgggtgccctgctctcggactttaacacgggctccttctcctactcc
tacggcacccgcaacgtcgtcgagtttcactccgaccataccaaggtccgtaacgccatc
ttcccgcgcgtgggcatgaagtttgtgctgcagaagctgattcagcgtatccctgccgct
atccagcactacagcccacggcccgtgcccacgaggcccgcccggaacgcgcccacgcct
cgcgacaccccgctgacccaggagtggctctggacccagatcggcgagtttctgcgtgag
ggcgacgttgtcgtcaccgagactggcacctctgccttcggcatcaaccagactcgcttc
cccaacaacacctacggcatatcccaggtcctgtgggggtccatcggcttcaccacaggc
gccaccctgggcgccgccatggccgcagaggagctcgacaaaaacaagcgcgtcattctc
tttatcggcgacggctccctacagctcaccgtccaggagatttcctccatggtccggtgg
ggtctacgtccttacctctttgtgcccaacaacgacggctacactatcgagaagctgatc
cacgggcccacggcccagtacaacgagatccagaactggcatcatctccggctacttccc
acctttggcgccacagattacgaggccgtgcgtgtggctaccacgggagagtgggacgcg
ctcacgaacgatccggccttcaaccgcaactctcgcatccgcctggtggaggtcatgctc
gaggtcatggatgcgccctcctcgctggtccgccaagcccagctcaccgccgcgacgaac
gcccagaactag

DBGET integrated database retrieval system