KEGG   Lachancea thermotolerans: KLTH0D13156gHelp
Entry
KLTH0D13156g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D13156p
  KO
K14792  rRNA biogenesis protein RRP5
Organism
lth  Lachancea thermotolerans
Brite
KEGG Orthology (KO) [BR:lth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lth03009]
    KLTH0D13156g
Ribosome biogenesis [BR:lth03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    KLTH0D13156g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: S1 TPR_19 Suf Mad3_BUB1_I DUF2025
Motif
Other DBs
NCBI-GeneID: 8295524
NCBI-ProteinID: XP_002553282
UniProt: C5DF89
Position
D:complement(1069076..1074271)
Genome map
AA seq 1731 aa AA seqDB search
MSSSGQKRKRVEESPLTRQDNTKQPSGPSLLQSVEEASFPRGGASALTPLELKQVANEAA
SDVLFGSGPAVASPAANDSQRPKKKKKTSPKAATGTKDAAGGDDESVAVIDHLTFRNLPV
GTLVLGRISKVNKHDLCVALSDNLCGFVTLPNISEPFTKLLEDIDESMESDKEASDDESD
AEYDNDDDDQKSSQAQAAKLKDLPDLNNFFTQGQWLRCSVHSNSALDKNSKKQKRIELSI
EPSATNQLIEEDLARNCTIQCAVKSIEDHGAILDVGMDGITGFISKKECESLPNFAPGTV
FLANVAKKSGRTVTVNFEFKNKKSKVSQISSVDAVIPGQAVDFLCQKKTSNGVIGKVFGL
VDGFLNISQQAIFYTDSKSDQAYPIGSNTRVRIIASLKNKSGDKFVILSDLPSVLSLASE
TSGNSALEAFPVGYTFENCEVKGRDSQYFYLKLNKDFLGRVHLSKTGEQEPSGEVSARVL
GYDSFDGYYQLATDPKVIAVEYLRPIDIPVGTIVPGCEITEVSDKGIKLSIFGGQFKATV
PPLHISDIRLVYPERKFKIGSKVKGILINATERGQLFMSLKKSLVNLDREETELASSFED
IEKIASSDSKLAATVDIFKPNGCIVSFLNGLRGFLPNSNISEAYVKRPQDHLRLGQTVIV
KVLQHNKEQNRVIVTCKVSSEAASLQREAIENMIVGRSIIKVAVVEKTKDSIVVEQVGTG
LRGVVYVGHLSDSRVEQNRAQLKKLKIGSELEGLVIDKDERTRVFNLSCKKSLMKDAEKS
LLPLNYQDVKQRGNHSPFNGYVKSVSEKGVFVAFNGQFVGLVLPSYAVDSRDVSLSSKFY
VNQSVSAFLLRTDDDNERFLLSFKEPKNEKSSKTPESERPAINPVDQSIKEVSEFALGKV
TKAKVKAVKKNQLNVVLSDNLHGRIDISEVFDKFEDIKDPKKPLATFKKGDVLDVKVIGF
HDVKSHKFLPVSHRSSKNVLIELSAKPSSLAGVNHATIKDVKVGDSIVGFVNNVSKDIMW
LTVSPSLKAKIDFFDLADENSQLGHGIEDSFPLGCALRTKVVSIDQDRNTLSVSARTHDI
KGIKDINVGDCLPARLLKITDSYLLLELGENVRGVAFATDALDDYSKPLKDVYANQKNSI
VSAKVISIDKDDGKLNLSLRSENPRDGTAKTHEDLKRGDVVRGLVKKITEKGIFIYLSST
LQAFVPVSKLTDSFIKDWRKFFKPMQSVVGKVVNCDDDSHILVTLKESEVNGELRILKSY
NDIKVGEIFEGAVKNVTDFGLFVKLDNTVNVTGLAHKTEVADSAVGDLASIFGVGDKVKA
IVLKVNPDKKQLSLGLKASYFKESNENQASDDAEGDEGSESSDEEVVNEEGQESDSDGME
VDDHEGEDKGDKSKQQPVLSSDGLSLSAGFDWTTSILDQAQEEESSEEEDFSETKRSKKK
KKSVQGVEDQTIDINTRAPESVGDFERMIMGNPNSSVIWMNYMAFQLQLGEIDKAREVAE
RALKTISFREEAEKLNIWIGLLNLENTFGTESTLNEVFSRACQYMDSYTIHSKLINIFQM
SHNFEKASLLFKTTAKKFGAEKVSIWVLWSDFLIEQGRAEEARQVLASALQSLPRRNHIE
VVRKFAQLEFAKGDSEQGRSLFEGLLADTPKRIDLWNVYLDQEIKSGDKKRVENLFERVV
NRKLTRKQAKFFFGKWLDFEEASDDQKTAEYVKAKASEYVEKLSQKSASVE
NT seq 5196 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctcggggcagaagaggaagagagtagaggaatctcctctcactcgccaagac
aacacaaaacaaccatcaggtccctcgcttctgcagagtgtggaggaggcttcattccct
agaggtggcgccagcgcgctgacgcctttagagctaaaacaggttgccaacgaagcagca
agcgatgtgctttttggatccgggcctgctgttgccagccctgccgctaacgacagccaa
agacctaagaaaaagaagaagacatcgcccaaggctgcgacaggtacgaaggacgctgct
ggtggcgatgacgagtctgttgcagtgattgatcacctcactttcagaaatctaccagtt
gggactttggtgctcggaagaatcagcaaagttaacaaacatgacctttgtgttgccctc
agcgacaacctgtgtgggtttgttactctaccgaacatctctgaacccttcacaaagctg
cttgaagacatagatgaatctatggaaagcgataaagaagctagcgacgacgagtcagac
gcagaatacgataatgacgacgatgatcagaaatcttcgcaagctcaggccgctaagctc
aaggacctgcctgatctaaacaacttcttcactcaaggtcagtggctgagatgcagtgtg
cattcgaattcggccctcgacaaaaacagcaagaaacagaagaggattgaactctctatt
gagcccagtgcaacaaaccaattgattgaggaagatcttgcgaggaattgcactattcag
tgcgccgtcaagagtatagaggaccacggtgccatacttgacgtgggaatggacggtatc
accggatttatctctaaaaaggaatgtgaatcgcttcccaacttcgcacctggtaccgtc
tttttggccaacgtggccaagaaatctggcagaactgtcacggtcaattttgagttcaag
aataaaaagagcaaggtgtcccagatatcctcagtcgatgctgtcattcctggccaagca
gtggacttcttgtgccaaaagaaaacttcaaatggcgtgattggtaaggtctttggtctc
gtagatgggtttctgaacatatctcaacaggcgatcttttacaccgatagcaaaagtgac
caggcatacccaattggttcaaatacgagagtaaggataattgcctctctcaaaaacaaa
tcgggcgacaagttcgtcattttgtccgacttgcctagcgttttatcacttgcgagcgag
acttcaggaaactcggctttagaagctttcccagttggttacaccttcgaaaattgcgaa
gtcaaaggacgtgactctcaatacttctatctaaagctcaacaaagacttcttgggacgt
gtccacttgtcgaaaacaggtgaacaggaaccatctggcgaggttagcgctcgcgttctc
ggttacgatagctttgacgggtattaccagcttgcaacagatccaaaagttatcgcggtt
gaatatttgaggcccatcgatattccagtaggtactattgttcccggatgcgagatcacg
gaagtctctgacaaggggataaaacttagcatttttggtggccagtttaaggcgactgtg
ccaccacttcatatctctgacattaggcttgtgtacccagagagaaagtttaaaattggc
tccaaggtgaagggtattttgataaacgccacagaaagaggccagctgtttatgtctttg
aaaaagtctctagtcaatctcgatagggaggagactgagctagcgtcaagctttgaggac
atcgaaaagattgcctcctctgattccaaattggctgctacagttgacatcttcaaacca
aatggatgcatagtttcattcttaaacggcttgagaggctttttacccaacagcaatata
tcggaggcctacgtcaagaggcctcaagatcatttgagactagggcaaactgtgatcgtg
aaggttttgcagcataacaaagagcagaaccgagtcattgtcacatgcaaagtttcaagc
gaggctgcgtcgttgcagagagaagccatcgaaaacatgattgtcggaagatcaataatc
aaggttgctgtagttgagaagacgaaggattctatcgttgttgagcaagttgggacagga
ttgagaggtgttgtttatgttggccacctgtctgattctagggttgagcaaaacagggca
cagctcaagaaactcaaaattgggtcagagcttgagggtttggtaattgataaagatgag
agaacaagggtttttaacctttcgtgcaaaaagtctttgatgaaggacgctgaaaagtcg
ctattgcccctgaactaccaggatgttaaacagagaggcaatcattccccattcaatggt
tatgttaaatccgtgtctgagaagggtgtttttgttgccttcaacggtcagtttgtgggt
ctagttctgccaagttatgcggttgacagtagagacgttagtctgtcttccaagttttac
gttaaccaatcggtttccgcattccttttaagaaccgacgatgacaacgagcgtttcctg
ctttcgttcaaggagccaaagaacgagaaaagctcaaaaacacctgaaagtgagcgccct
gctatcaaccccgttgatcaatccatcaaggaagtatccgaatttgcgcttggaaaagtt
acaaaggctaaggtcaaagcagttaaaaaaaaccagctaaatgtcgtcctttccgacaac
cttcatggaaggattgatatctctgaggtcttcgacaaatttgaagacatcaaagatccc
aagaaaccacttgccactttcaaaaagggtgacgtcttggatgtcaaggtcattggattt
catgatgtcaagtctcacaagttcttgcccgtatcgcacagatcttctaagaacgttttg
attgagctttctgcgaagccatcctccctagctggtgtcaatcacgccacaatcaaagat
gtcaaagtgggcgactcaatcgtgggatttgtgaacaacgtttcgaaggacatcatgtgg
ctgactgtctcgccttccttgaaggctaagatagatttctttgatttggctgatgagaac
tcacaactcggccatggcatcgaagactctttcccattaggttgcgctctcagaacaaag
gttgtcagcatcgaccaggatcgcaacactctatcagtatcagcaaggacgcatgacatc
aagggcatcaaagacattaacgtcggcgattgtctgccagcgcgcttgctcaaaattaca
gacagctatctcttgttagaacttggcgagaatgtgagaggcgtcgcgttcgccactgat
gccttggatgattattcgaagcctttgaaggacgtctacgcaaaccaaaagaacagcatt
gtgtctgccaaagtgatctctattgacaaagatgatggcaagcttaacctatctcttcgt
tctgaaaacccaagagacggtactgcaaaaacacacgaagatctgaagagaggagatgtc
gtgcgtggacttgttaagaaaataaccgagaagggtattttcatttacttgagcagcacg
cttcaagcgtttgtgcctgtcagtaagttaactgattctttcattaaggactggcggaag
tttttcaaaccaatgcaaagtgttgttggtaaggttgtcaactgtgatgatgactcccat
atattggttactttgaaagagtcggaagttaatggagaattgagaattttgaagagttac
aatgacatcaaggttggcgagatttttgaaggtgccgtcaaaaatgtcacggatttcggc
ttatttgttaagcttgacaacaccgtgaacgtcaccggtcttgcccataaaaccgaagtg
gctgattccgctgtcggcgatttggcttcgatattcggtgtcggtgataaagtcaaggca
attgtcctcaaagttaatcctgacaaaaaacagctttctctcggtctcaaagcttcttac
ttcaaagagagtaatgagaatcaggcgtctgatgatgcggaaggggacgagggctctgaa
tccagcgatgaagaagttgtgaatgaagaaggccaggaaagcgactctgacggcatggag
gtcgatgaccatgaaggcgaagataagggtgacaagtcaaagcagcaaccagttttgtct
agcgatggtttgagtttgagtgcaggatttgattggactacaagcattttggatcaggct
caagaagaggaatcctctgaagaggaagatttcagcgagaccaaaaggtctaagaagaaa
aagaagtcagtgcagggtgtcgaggatcaaaccattgatatcaacaccagagcgcctgaa
tctgttggtgacttcgaacgcatgatcatgggtaatccaaactcttctgttatctggatg
aactacatggcattccaattgcagcttggagaaattgacaaggcacgtgaagttgctgag
cgtgctttgaagaccataagcttcagggaagaggctgagaagctgaacatatggatcggt
ttgctcaatttggaaaacacgtttggtactgagagtactctaaatgaagttttctcaaga
gcatgtcagtacatggactcctacacaattcacagcaagctcatcaacattttccaaatg
agccacaactttgaaaaagcttctttattgttcaaaacgactgcaaagaaatttggtgcg
gagaaggtctctatttgggttctgtggagtgatttcttgattgaacagggacgtgctgaa
gaagcacgccaagttcttgccagtgctttgcagtctttgccgagacgtaaccacattgaa
gttgtgcgcaaatttgcccaacttgaatttgctaaaggcgacagcgagcagggccgttcg
cttttcgaggggttgcttgccgacactccaaaaagaatcgatttgtggaatgtttaccta
gatcaagagatcaaatcaggcgacaagaagagagttgagaatttgttcgagagagttgtg
aacagaaagctaacgagaaagcaagccaaatttttctttggtaagtggcttgattttgag
gaggcctctgatgaccaaaagactgccgagtatgttaaggcaaaggcctcagagtatgtt
gagaagctaagccaaaagtcagcatctgtagaataa

DBGET integrated database retrieval system