KEGG   Lachancea thermotolerans: KLTH0D14344gHelp
Entry
KLTH0D14344g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D14344p
  KO
K10577  ubiquitin-conjugating enzyme E2 I
Organism
lth  Lachancea thermotolerans
Pathway
lth03013  RNA transport
lth04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:lth00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    KLTH0D14344g
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    KLTH0D14344g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lth03019]
    KLTH0D14344g
   04121 Ubiquitin system [BR:lth04121]
    KLTH0D14344g
Messenger RNA biogenesis [BR:lth03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     KLTH0D14344g
Ubiquitin system [BR:lth04121]
 Ubiquitin-conjugating enzymes (E2)
  UBL-conjugating enzymes
   KLTH0D14344g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UQ_con Prok-E2_B
Motif
Other DBs
NCBI-GeneID: 8295577
NCBI-ProteinID: XP_002553333
UniProt: C5DFE0
Position
D:complement(join(1178849..1179284,1179376..1179413))
Genome map
AA seq 157 aa AA seqDB search
MSSLCLQRLQEERKKWRKDHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPI
TIEYPDDYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQDWRPAITLKQIALGVQDLL
DSPNPNSPAQEPAWRAFSKNVKEYERKVIEQAKRYTK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtttgtgtttacagcgtttgcaggaagaaaggaagaagtggagaaaggaccac
cccttcggctttttcgcaaagcccaccaagaagccagatggttctatgaacttacaaaaa
tgggaagctgggatacctggcaaagagggaacaatttggaaagatggcgtgtttcccatt
accatcgaatatccagacgattacccttcgaaacctcctaaagtgaagttccccgccggg
ttctaccacccgaatatataccccagtggaacggtgtgcctgagtattttgaatgaggac
caggactggaggcccgctattacccttaagcagatcgcgctgggggtgcaggatctcttg
gacagtcccaaccccaactcgcctgcgcaagaaccggcgtggcgagccttctccaaaaac
gtgaaggagtacgaaaggaaagtgatagagcaggctaaaagatacacgaagtga

DBGET integrated database retrieval system