KEGG   Lachancea thermotolerans: KLTH0D15950g
Entry
KLTH0D15950g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D15950p
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
lth  Lachancea thermotolerans
Brite
KEGG Orthology (KO) [BR:lth00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lth01009]
    KLTH0D15950g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     KLTH0D15950g
Protein phosphatases and associated proteins [BR:lth01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     KLTH0D15950g
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 8295751
NCBI-ProteinID: XP_002553401
UniProt: C5DFK8
Position
D:complement(1318854..1320533)
AA seq 559 aa
MSKDISKAQENTKKINAALKIIKNKPGECDNSSGKTTADLTTYTLENGTRVSTKERVCSS
VRPVALGTPTDAELFQGNGLPNHDFLREHFRREGRLSETQVLRILKMATDCLSREPNLLQ
VPAPVTVCGDIHGQFYDLLKLFEVGGDPQKTPYLFLGDYVDRGSFSIECLLYLYSLKLNF
NQHFWLLRGNHECKHLTSYFTFKSECLHKYNLKIYESCCQSFNALPLAAVMNGQYFCVHG
GISPELRSLDDINRMDRFKEIPSRGLMCDLMWADPTETYDEDADDPSGTKFVPNSVRGCS
FAFTYQAACEFLQKTGLLSIIRAHEAQDAGYRMYKNTETLGFPSLLTLFSAPNYLDAYKN
KAAVLNYSNNVMNIRQFNMSPHPYWLPNFMDVFTWSLPFVGEKVTEMLVSILNICTEEEL
EEETPMIQEDVGKADVAYKNSQETTSGVSGAKPTSSILNNEAKRRALRSKIMAIAKVSRM
YSILREESEKVEYLKTINAGILPRGALAHGPEGLKEALSTFEKARREDLVNERLPPKLQE
VDKQRNDYYKQIVREKNGS
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcaaaagacataagcaaggcccaggaaaataccaaaaaaatcaatgcagccctgaag
ataatcaaaaataaacccggggaatgcgacaactcttccggaaagacaacagcagaccta
acaacgtacactcttgagaacggaacacgggtttctacaaaggaaagagtatgtagctct
gtccgtcctgtcgcattgggcactcccacggacgcggagctcttccaggggaacgggctc
ccaaaccacgactttttgagagagcattttcgtcgcgagggccgtttgagtgagactcaa
gtgctgcggatattgaagatggctacagactgcctatcccgcgaacccaaccttcttcag
gtgcctgctcctgtcacggtgtgtggtgacattcatgggcagttctacgatttgctgaaa
ttatttgaggtgggcggagacccccagaagacgccttacctatttttgggcgattatgtc
gatcgaggctcattttctatcgagtgtctgttgtatctttacagtttgaagctgaacttt
aaccaacacttttggttactaagaggcaatcatgaatgcaagcacttaacctcctatttc
acgttcaagagcgaatgcctgcataaatacaacctcaaaatttacgaatcctgctgtcaa
tcgttcaatgccttgcctttggctgccgttatgaatggccagtacttctgtgttcatggc
ggtatatctccagaacttcggtcgctggatgatatcaatagaatggaccggttcaaggaa
ataccttctcgtggattgatgtgcgatttgatgtgggcagatcctacagagacttacgac
gaagacgcagacgatccttcaggaacgaaattcgttccaaactctgtgagaggatgttcg
tttgccttcacttatcaagctgcgtgcgaattcttacaaaaaactgggctgctttctatt
ataagagcacacgaagcacaagatgctgggtacagaatgtacaagaatacagaaacatta
gggtttccgagcttgctgacgttgtttagcgcccccaattatctagacgcttacaaaaat
aaagcggcggtgcttaactactctaacaacgtcatgaacataagacaatttaacatgtcg
ccacatccatattggcttcctaactttatggacgtatttacttggtctttgccatttgtc
ggagaaaaggttaccgaaatgttggtttccatcctgaacatctgcacagaggaagagctg
gaggaagagacaccaatgatccaggaggacgtggggaaggctgatgttgcctacaagaat
agccaagaaacgacatcaggtgtctccggagcaaagcctacttcgtccatattaaacaac
gaagctaaaagacgcgcgttgagaagcaagatcatggcaatcgcgaaggtttcacggatg
tactcaattctgagggaagaaagtgagaaggtcgagtatctcaagacaatcaacgcagga
atattgccaaggggtgcattagcacacggccccgaagggctgaaggaagcactgtcgaca
ttcgaaaaagcgcgccgcgaggacttggtcaacgaaagactaccgccaaagctgcaagaa
gttgacaagcagcgtaacgattattacaagcaaatcgtaagggaaaagaatggtagttaa

DBGET integrated database retrieval system