KEGG   Lachancea thermotolerans: KLTH0E01496g
Entry
KLTH0E01496g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E01496p
Organism
lth  Lachancea thermotolerans
SSDB
Motif
Pfam: OPT
Other DBs
NCBI-GeneID: 8291692
NCBI-ProteinID: XP_002553554
UniProt: C5DH56
Position
E:complement(146000..148444)
AA seq 814 aa
MKNVLKSILSSDAPVTDKKLLHPADSSSGAAASSASDAGKGKGDTIVVTERDSSDHDIEK
SRSVGLAALRSADYDPLGGKISAIAENDEYAGITVEDDSPYPEVRASVPSTDDPSLVQNT
IRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTTFVTSILAWPLGRAWDMVMPDKPVFGRFG
GPSLNPGPFNVKEHALITAMGNVAFGSGNAYATDIILSMNNFYNKDFGWGFDLLAVWSTQ
CIGFAMAGLSRKVLVTPASMIWPANLVTCTFLTNMHINENHVANGWKISRLKFFMIVFIV
GFVYYWFPGFIFQALSYFAWVTWIKPKDVIVNQVFGASTGLGLIPLTFDWNQIAGYVGSP
LVPPLGVIATILLSMVIIFWIVVPAVHYSNIWYGKYLPISDSGSYDRFQNTYNVSKIVSE
SLTFNKDAYREYSPLYLSATFAISYGLSFAGTMATITHAICFHGKQIWGAIRNITSSEEE
DVHAKLMRNYRDVPQWWFIVVFLIFFGLSIATVRAWPTEMPVFTLIIALLIAFFFLLPVG
IIYALTNIAVGLNVITEFIIGYMTPGKPIAMMFFKTFGYITNNQAITFAQDMKIGHYMKV
APRVLFSAQLVATVWGGLVQMCVMKWAQGNIEDICTSKQKSHFTCPGSKVFFNASIIWGV
IGPQRMFSAGQMYDKLMYFFILGAGLPVVNWLVLKKWPRSLVRYLNWPVFFSGTGLIPPA
TPYNYGAYCMVGIFFGYFIKKNYFNWWAKYNYSLSAGLDISLAWSSLIIFLALGLTNTDA
PSWWGNNVINTIDYDGTAIQHQLTDGESFGLKKW
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgaaaaacgtactcaaatctattctgtcttcggacgccccggtgacagacaagaaactg
ctccatccggcggacagcagcagcggcgctgccgccagctccgccagcgacgccggcaag
ggcaaaggtgacacgatcgtggtgacagagcgcgactcgtccgaccacgacatcgaaaag
agccgttccgtaggcctcgccgcgttgcggtccgcagactacgacccgctcggaggtaag
atctcggcgatcgcggagaacgacgagtacgcgggtatcaccgtcgaggacgactcgccg
taccccgaggtgcgtgcctccgtgccttccacggacgacccgtcgctcgtgcagaatacc
atcagaatgtggaccatcggcatgatcatgacgacgatcgggtgcgggctgaacatgctg
ttctccatgcactcacccacgattgtgctgacgacgttcgtgacgtcgatcttggcgtgg
cctctgggtcgcgcatgggacatggtgatgcctgacaagcccgttttcgggcggttcggc
ggcccctcgctcaacccgggtcctttcaacgtcaaagagcacgcgctcatcacggccatg
ggtaatgtcgcgtttggctcgggaaacgcgtacgccacggacatcatcttgtcgatgaac
aacttctacaacaaagacttcggatggggctttgacctgctagccgtatggtccacgcag
tgcatcgggttcgcgatggcggggctgtcgcgtaaggtgctagtgacgcccgcgtcgatg
atctggcccgccaacctggtcacgtgcaccttcctcaccaacatgcacatcaacgagaac
cacgtggccaacggctggaagatctcccgcttaaagtttttcatgatcgtcttcattgtg
ggcttcgtgtactactggttccccggcttcattttccaagcgctgtcctacttcgcgtgg
gtcacgtggatcaagcccaaggatgtcatcgtcaaccaggtcttcggcgccagcaccggc
ctcggtctgattccgctcaccttcgactggaaccagatcgccggttacgtcggatcgcct
ctggtgcctcctctgggcgtcattgctaccattctgctgtccatggtcattatcttctgg
attgtggtccccgctgtccactactccaacatctggtacggcaagtacttgcccatttca
gactccggctcgtacgaccgttttcaaaacacttacaatgtgtcaaagatcgtttcggag
agcctgaccttcaataaggacgcttacagggaatattcaccgctctacctgtcggccacc
tttgcaatttcctacggcctatcatttgcgggtaccatggccactatcacacacgcgatc
tgtttccacgggaaacagatctggggagcgattcgcaatattacctcctcagaggaagaa
gatgttcatgctaagctgatgcgcaactacagggatgtgcctcagtggtggtttatcgtt
gtgttcttgattttttttggtctttccatcgcaactgtgagagcctggcctaccgagatg
cctgtttttacattgatcatcgcacttctgattgcctttttcttcttgctcccagtcggc
atcatttacgctctaaccaacattgctgtggggttaaatgtcatcaccgaatttatcatt
ggatacatgacccctggtaagccaattgccatgatgttcttcaagacatttggttacatt
accaacaatcaggccatcactttcgctcaggacatgaagatcggccattacatgaaggtt
gcacccagagtgttattcagtgcgcaactagtcgctactgtttggggtggtttggtccag
atgtgcgtcatgaagtgggcacagggcaacattgaggacatctgcacgagcaagcaaaaa
tcccactttacttgccccggctccaaggtgtttttcaatgcctctatcatctggggcgtg
attggtcctcaaagaatgttctctgctggccagatgtatgacaagctcatgtactttttt
attctgggcgccggtctcccagttgtgaactggctagttttgaaaaaatggcctcgctcc
ctcgtcaggtaccttaactggcccgtgttcttctcaggaacggggttgatccctccagct
accccttacaactatggtgcctactgcatggttggaattttctttggctacttcatcaag
aagaattatttcaactggtgggctaagtacaactactcactgtctgccggtctcgacatt
tctctagcgtggtcctcgttgatcatctttttggcgcttggtctcaccaacaccgatgcg
ccaagctggtggggaaacaacgttatcaacaccattgactacgacggtaccgcaattcag
caccagcttacggatggcgaaagcttcggccttaaaaagtggtag

DBGET integrated database retrieval system