KEGG   Lachancea thermotolerans: KLTH0E13090gHelp
Entry
KLTH0E13090g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E13090p
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
lth  Lachancea thermotolerans
Pathway
lth00260  Glycine, serine and threonine metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0E13090g
Enzymes [BR:lth01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KLTH0E13090g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 8292215
NCBI-ProteinID: XP_002554046
UniProt: C5DIJ8
Position
E:complement(1162705..1163859)
Genome map
AA seq 384 aa AA seqDB search
MPDLPQYTTSYNDFRSDTFTIPTPDMFAAGANASVGDVIFQEDACTCLLEQRVSQELLGG
KLYGGSEAQGLFCMSTTMSNQIAIRAHLNFAPPFSILCDKRAHVYVDECAGIAVLSQALV
VPVAASNDRFLTLEDIQEAYIPDDGDIHLAPTRLICLENTLHGMCFPYEELKRISDWCHE
EGIKLHLDGARFWNAACSSGEDPVGYMRKVGPLFDSLSLCFSKSLGAPIGSMLVGGPEFR
ARARHLLKQQGGGIRQAGFITKIAAYCLDRNFPQAVAEVSSKTLEFWEDLYTTLKDKYAM
ELRLAHPVETNFIFIDLASSGINMSKFLEIGERNNVRLFDGRLAFHYQNIKPEGLALLKK
TFTDVAEYYQKNDYKPEGRSTRIY
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatctcccccaatacaccacttcctacaacgacttcagatcggacaccttcacg
atccccacgcccgacatgttcgcagccggagccaacgcgtccgtgggtgatgtgattttc
caggaggatgcctgtacctgcctattggaacagcgcgtttcccaggagctcctcggagga
aaactttatggcggctccgaggcgcagggtttattctgtatgtccaccaccatgtccaac
caaatcgccatccgagctcacttgaactttgcccctccctttagtattctgtgtgacaaa
agggcgcatgtttacgtggacgagtgcgccggcatcgcagtcctatctcaagcgctggtc
gtgccagtcgctgcttccaacgacagattcttgacccttgaagacattcaggaagcctac
atccccgatgatggcgacatccatctcgccccgacaagactcatctgccttgaaaacacc
ctgcatgggatgtgcttcccctacgaagagctcaaacgcatcagcgactggtgccatgag
gagggcataaagctacatctggacggtgcgcgattctggaatgcggcgtgcagttctgga
gaggaccccgtcggctacatgcgcaaagtcggccccctgttcgactccttgtccctctgt
ttctcgaaatctctaggcgcgccgattggctccatgcttgttggaggaccagaatttagg
gccagggcacgccacttgctcaagcagcagggtggcggaattcggcaagcggggttcata
accaagattgcagcttactgtttggatcgcaactttccacaagccgttgcagaggtctca
tccaaaactctggagttttgggaggacctttacaccactctgaaagacaagtacgccatg
gagttgaggcttgctcaccctgtcgaaacaaacttcatatttattgatttggccagttcc
ggcataaatatgagcaagtttctggagattggtgagcgtaacaacgttaggttatttgat
gggagattggctttccactaccagaatatcaagcccgaaggtcttgccttgcttaagaag
acatttacagacgttgcagaatactatcagaaaaatgattataaacccgagggacgttca
accagaatatactaa

DBGET integrated database retrieval system