KEGG   Lachancea thermotolerans: KLTH0F06688gHelp
Entry
KLTH0F06688g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F06688p
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00260  Glycine, serine and threonine metabolism
lth00680  Methane metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
lth01230  Biosynthesis of amino acids
Module
lth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lth_M00002  Glycolysis, core module involving three-carbon compounds
lth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0F06688g
  Energy metabolism
   00680 Methane metabolism
    KLTH0F06688g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0F06688g
Enzymes [BR:lth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KLTH0F06688g
Membrane trafficking [BR:lth04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KLTH0F06688g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KLTH0F06688g
  Exosomal proteins of melanoma cells
   KLTH0F06688g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 8292696
NCBI-ProteinID: XP_002554495
UniProt: C5DKQ7
Position
F:583833..584738
Genome map
AA seq 301 aa AA seqDB search
MTGSDTYKLFVLRHGQSELNHENIFCGWIDAGLTEKGKAQAKNAAALIKVHCMANSLEPP
KIGYTSRLVRTQQTIEVMLEELNIKPNYRVVTKSTNVDKILREEWSREEALVLQTWRLNE
RHYGAWQGQRKPTILQEYGKEQYMFIRRDYNGRPPAADLSREMVQEVDDKGSLTGYDFKE
PNRRVKYNLEEHSGETLPNNESLSDVVERLDGFLNQIILKNLDYCSSGLVVAHGSSVRSI
LKIIEGISDTDIKDVEIPNAIPLVIELDRHTKMFVRKYYLDPELAKINAEKVRNEGFEKR
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcagatacgtacaagctatttgttctaagacatggtcaaagcgagctgaac
catgaaaacatcttctgcggttggatcgatgctggcctcacagaaaaaggtaaagcgcaa
gccaagaatgcagcggcgctaataaaagtccactgcatggcgaattcccttgagccacct
aagatcggatatacttcaaggctggttaggacacagcaaacgatcgaagtaatgcttgaa
gagctcaacatcaaacccaactacagggttgtaacaaagtcgaccaatgttgacaaaatt
ttgagggaggaatggagtcgtgaagaggctttggttttgcagacgtggagattgaacgag
cgtcattatggggcctggcagggccaaagaaaacccaccatcttgcaggaatacggcaaa
gaacaatatatgtttatcagaagagactacaacggtaggccccctgctgcggacttgagc
agggaaatggtccaggaggtcgatgacaagggctccttgacaggttacgactttaaggaa
cctaacagaagagttaagtacaatcttgaagaacattctggcgaaacgcttccaaacaac
gagtctctcagtgatgtggttgagcggctcgatggcttcttaaaccagatcattttgaaa
aatctggactactgctcgtcagggctcgttgtggctcacggaagttcagttcgctcaata
ctgaaaatcatcgagggaatctccgacactgacattaaagatgtggaaatccctaacgca
atccctcttgtaatcgaattggacaggcacaccaagatgtttgtacgcaagtattatctg
gatcccgaactcgccaagatcaacgcagaaaaggtccgcaacgaggggtttgaaaagcgt
gactaa

DBGET integrated database retrieval system