KEGG   Lachancea thermotolerans: KLTH0F10824g
Entry
KLTH0F10824g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F10824p
Organism
lth  Lachancea thermotolerans
SSDB
Motif
Pfam: Arrestin_N SfsA
Other DBs
NCBI-GeneID: 8292884
NCBI-ProteinID: XP_002554672
UniProt: C5DL84
Position
F:923729..925018
AA seq 429 aa
MSTTVRVVLDPPSNGEFYTLEDVIAGSVVLGLEKSVNIREVMVKLVGQSEAVVRPGDHLE
NEKPQSLQVPLSDNRSLHEVVKLESSVFPPENVKAAMKGSRKPFKVEKGEYKFPFEFHFP
SRPQCIQRHQRKLFTYLKGRTNPKLPPSFNNLLSSKDVLNLNAYFYSLGCIEYFVEATVF
TGGDEMWFKPFRSYPALKRTFEFIPSNVAQEHLEDALRENPNTPPQVFRSKFDVTFEGSE
QQMWVEVRSKHLRSVYRLDYLFRPSGKKFNQVFLCMLNPLPESADLRVARVELNLIEVVT
YLAGNRSNANLSSLRLAGVDTDYKVDLTKCQQTESGFTECHVELSDIYPLDMIRFNEEDY
KHNGNRLYSFDSCNIRRRFKFQLFLHWTLNGVDHFQTEVLTNFTNIFCESVTVAEQPPDY
MEEQLPKYE
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtctaccacagttagggttgtgctcgatcctccctcaaatggggaattctatactctg
gaagatgttatagctggaagcgtggttctggggctcgagaaatctgtgaatatcagggag
gtaatggtgaagcttgtgggacaatctgaagcagtagtgaggcctggcgatcacctagaa
aatgaaaagcctcaaagccttcaagtacctttatcggacaataggtcgcttcatgaagtc
gtaaagcttgaatcctccgtttttccgccagaaaatgtcaaagctgctatgaaaggttca
aggaagccctttaaggtcgaaaaaggtgaatacaaattcccttttgaatttcatttccca
agcagaccgcaatgcatccagaggcatcaaagaaagctttttacatatttgaagggacgc
actaaccctaaactgccgcctagctttaacaacttgctaagttccaaagatgttttgaac
ctaaacgcctacttctattcgctgggctgtattgaatacttcgtcgaagcaacagtcttt
accggtggtgacgagatgtggttcaagccgtttagaagctaccctgctctgaagcgtact
ttcgaatttattccgtcgaacgtcgcgcaagagcacttagaggatgccctaagggaaaat
ccaaacacccctcctcaggtatttcgctccaaattcgatgttacgtttgagggcagcgaa
cagcagatgtgggtcgaggtacgttctaaacacctgcgatccgtgtaccgacttgactat
ctcttcaggccctctggtaagaagttcaaccaagtctttctgtgcatgcttaatcccctg
ccggagagcgcagatctaagggtggctagggtggaattgaatctgatagaagttgttaca
taccttgctggaaaccgctcaaatgcaaatcttagctccttaagacttgccggggtcgac
acagactataaagttgatctaacaaagtgtcagcaaacggaaagtggattcactgaatgc
cacgtcgaactgtctgatatctatcctctcgatatgattcgatttaatgaggaggactat
aagcacaatggaaaccgtctttacagctttgattcatgcaacattaggcgtagattcaag
tttcagctgtttctgcactggacgctaaacggagtggatcatttccaaactgaggttctc
actaactttactaatatcttttgcgaatctgtcacggtagctgagcagcctccagactac
atggaggagcaactgccgaagtatgaataa

DBGET integrated database retrieval system