KEGG   Lachancea thermotolerans: KLTH0G10582gHelp
Entry
KLTH0G10582g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G10582p
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
lth  Lachancea thermotolerans
Pathway
lth00600  Sphingolipid metabolism
lth01100  Metabolic pathways
Module
lth_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    KLTH0G10582g
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     KLTH0G10582g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 8293771
NCBI-ProteinID: XP_002555493
UniProt: C5DMP5
Position
G:893699..895000
Genome map
AA seq 433 aa AA seqDB search
MPVIHGPAPSFMYQCLPVVMRVWSYSARRSSNLLSVSTYVKKKFMVGSRSHSCVRYKVLD
KQEDGTRWPSKELGKPEMSSELKQRKVHAGQVATGSQEPVEKQKHRRQKKVASRVDRYSC
MLSTAFFALLYLGSKVKPEFTSKFTTLQYKYADVADAYDIGIDDAYMVVTCIVALVMVRS
FLLEFVLKPIALRRFHIQSRKSQQRYAEQGWSLVYYTFSWVLGFYLYCQSPYFLNCDHIY
LGWPHDRLSSTFKMYYLLQISSWLQQIVVLNVEERRKDYWQMFAHHIITCLLTLGSYYYY
FTRIGHVILIMMDIVDVFLSSAKMLKYCGFTTACDYMFAVFLVFWVLLRHIAYNYIFYHA
GTKAPGLMSHGQCMASAVQKRCWTPLVIDIFLWLLGGLQVITIIWMALIIKVLIKILKGG
SAEDVRSDEDDSD
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttatacacggcccagcgccctcgttcatgtatcaatgcttgcctgtcgtaatg
cgagtttggtcgtacagtgcgagaaggtcttcgaaccttttgtcggtttcaacctacgtg
aaaaaaaagtttatggtgggatctagatcacattcatgtgttcgatataaagtcttggac
aagcaggaagacggcacgcgttggccttctaaagaacttggaaagcccgagatgagcagc
gaactgaaacagcgcaaggtgcatgcgggccaggtggcaacaggttcacaggaacctgtg
gaaaaacaaaagcatcgcagacagaagaaagtcgcatcgcgcgtggatagatattcatgc
atgctctcgacagcattctttgcacttctttatttggggagcaaggtcaagcctgagttc
acaagcaagttcactactttgcaatacaaatacgccgacgtggccgacgcgtacgacatc
ggcattgacgatgcgtacatggtggtcacgtgcattgtggctttggtgatggtgcgttcg
tttctgctggagttcgtgttgaagcccattgctttgcgccgattccatatccagtcgcgc
aaatcgcagcagcgttacgctgagcagggctggtcgctcgtctactacactttttcgtgg
gtgcttggattttacctatactgccagtccccttacttcctaaactgtgaccatatctac
ttggggtggccgcacgatcggctttcgtcaacctttaagatgtactacttgctacaaatt
tcttcctggctacagcaaattgtggtactcaacgttgaggaaagacgtaaggactactgg
cagatgtttgcccaccatatcatcacatgcttactcacactgggctcttactattactac
ttcacccgtatagggcatgtcattttgattatgatggacattgtcgacgttttcctctcg
agcgcgaaaatgctcaagtactgcggcttcacgaccgcttgcgactacatgtttgcggta
ttcctcgtgttttgggttcttttgagacatattgcatacaactacatcttctatcacgcc
ggcactaaggctcctgggcttatgtcgcacggccaatgcatggcgtctgctgttcagaaa
agatgctggacgcctctcgtcatcgacatattcctgtggctattgggaggtttacaggtc
attaccatcatatggatggctctcattataaaagttctcatcaagattctaaagggtgga
agcgccgaggatgttaggagtgatgaagacgacagtgactaa

DBGET integrated database retrieval system