KEGG   Lachancea thermotolerans: KLTH0G19536gHelp
Entry
KLTH0G19536g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G19536p
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00270  Cysteine and methionine metabolism
lth00620  Pyruvate metabolism
lth00640  Propanoate metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0G19536g
   00620 Pyruvate metabolism
    KLTH0G19536g
   00640 Propanoate metabolism
    KLTH0G19536g
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KLTH0G19536g
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lth04147]
    KLTH0G19536g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     KLTH0G19536g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   KLTH0G19536g
  Exosomal proteins of breast milk
   KLTH0G19536g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C UDPG_MGDP_dh_N Glyco_hydro_4 AlaDh_PNT_C 3HCDH_N DAO Sacchrp_dh_NADP TrkA_N NAD_binding_7 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 8294172
NCBI-ProteinID: XP_002555876
UniProt: C5DNS8
Position
G:1688018..1689001
Genome map
AA seq 327 aa AA seqDB search
MPHSIYPPASTIKKVNPVKVAVIGVGSVGSTTAYTLLFSEMISEVVLIDINTHKAEGESM
DLNHAAPSTTGSVVYVGDYSDCADAAIVIITGGANQKPGQTRMDLAATNARILQGIIPKI
VEYAPKTILLIATNPVDVLTYVSYKVSGFPLNRVIGSGTLLDSARLKYHLSQHFKTSSKN
VDAFIVGEHGDSSLPVWSHVKISGIRLRDYCEQSQQAYDHELFHQMFEKTRNAAYDIIER
KGYTAYGIAAGILRIVETILKDGGSPLTVSTVGNYFGIEQVALSVPTKLNRNGAHSPVDL
SFDIKEIELIKKSALQIKSVCSTLELL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccccattctatctacccaccagcctcaaccatcaaaaaagtgaaccctgtcaaggtt
gctgttattggtgttgggagtgtgggctctactacggcctacactctgctatttagcgag
atgatctcggaagttgtgttgattgatatcaacacacataaagcagagggcgaaagcatg
gatttaaaccatgctgcaccttccacaacaggttctgttgtgtatgttggagattatagc
gactgcgccgacgctgcgattgtgatcattacaggtggcgccaatcaaaaacctggtcaa
actagaatggatttagcagcaacaaacgcaagaatcttacaaggtattattcccaagata
gttgagtacgccccaaaaactattcttctcattgccactaatccagttgatgtcctcaca
tatgtcagctataaagtgtcaggctttcctcttaacagagttattggatcgggtacgctt
ctcgactcggcaagacttaagtaccacttaagtcagcattttaaaacttcttcaaaaaat
gtggatgcctttatagtcggagagcatggagattcatcacttcctgtttggtcgcatgtc
aagatttctgggatcagattacgtgattactgcgagcagtctcaacaggcttacgaccat
gaacttttccaccaaatgtttgaaaaaacgcgtaatgcagcgtacgatatcattgagcgc
aaaggttatacggcgtatggtatcgcagctggaattcttcgtattgtcgagactattttg
aaagacggaggctccccgctcactgtttcaacagttggaaattattttggtattgagcaa
gtcgcactcagcgttccaacaaagctcaacagaaatggcgcccatagcccagtcgatttg
tcatttgacatcaaagaaattgaattgataaagaaatctgctcttcaaatcaagtctgta
tgcagtactctcgaattgttgtaa

DBGET integrated database retrieval system