KEGG   Lachancea thermotolerans: KLTH0H01254gHelp
Entry
KLTH0H01254g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H01254p
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00071  Fatty acid degradation
lth00350  Tyrosine metabolism
lth00680  Methane metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0H01254g
  09102 Energy metabolism
   00680 Methane metabolism
    KLTH0H01254g
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KLTH0H01254g
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    KLTH0H01254g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KLTH0H01254g
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     KLTH0H01254g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N Sacchrp_dh_NADP TrkA_N HycI
Motif
Other DBs
NCBI-GeneID: 8294245
NCBI-ProteinID: XP_002555932
UniProt: C5E209
Position
H:121076..122221
Genome map
AA seq 381 aa AA seqDB search
MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEG
AFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQG
KGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTT
GYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGAT
DFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVA
AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDI
NSAFEDLHHGDCLRTVLDLSK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaggaaaacctataacttgtactgctgccgtcgcctacgaggccggcaaacct
ttgactgttgaggagatcgtggtggatccacccaaagcgcatgaggtgcgcatcaaagtt
gagtacaccgccgtctgccatacggatgcatacacactgagtggtgttgacccagagggc
gcgttccccagcattttgggccacgagggcgcgggtgtcgtggagtcggtcggcgaaggc
gtcacgaacgtcaaggccggcgaccacgtaattgcgctctacactgctgagtgcaaagag
tgcaagttctgcaagtcgggcaagactaacctgtgcggctctgtgagggccacacagggc
aagggtgtgatgcccgacggaacctcgagattccacaacaaaaagggtgaggacctgcta
cacttcatgggctgctcaacgttctcacagtacacagttgttgccgacgtttctgtagtg
gctattgaccctaaggcgccgctagataagacttgtctgctagggtgcggtgtcaccacc
ggctacggcgcggctgtgaagaccgccgacgttcaaaaaggcgacacagttgcaattttt
ggcgcaggtacggtgggtctctccgtggtgcaaggtgcacacgtcagaggtgcatccaag
atcattgttgttgacatcaacgaccaaaagaagcaatggtcattggacttcggtgccaca
gactttgtcaacccctccaaaggtctcaaagatggccaaactattgttgataaattggtt
gagatgactgacggcggtttggacttcacttttgactgcaccggtaacaccgacgtcatg
agaagcgcgcttgaagcatgtcacaagggctggggccagtccatcattatcggtgtcgcg
gctgcgggcaaagaaatctcaacaagaccattccaactcgttactggtagagtgtggaag
ggctctgcttttggtggcatcaaaggaagatctgagatgggcggtctagtctcggattac
atggacggcaagctcaaggtcgacgaattcatcacacacagaaggggcttcaccgacatc
aacagcgcctttgaagacctccaccacggcgactgcctaagaacagtgttggacttgtcc
aaataa

DBGET integrated database retrieval system