KEGG   Lachancea thermotolerans: KLTH0H05588g
Entry
KLTH0H05588g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H05588p
  KO
K23856  peroxiredoxin [EC:1.11.1.24]
Organism
lth  Lachancea thermotolerans
Brite
KEGG Orthology (KO) [BR:lth00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KLTH0H05588g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     KLTH0H05588g
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 8294437
NCBI-ProteinID: XP_002556122
UniProt: C5E2J9
Position
H:complement(496922..497407)
AA seq 161 aa
MSKFYDLAPLDRTGKPFPFKQLEGKVVLIVNVASKCGFTPQYEELQELYKRYHDKGFEII
GFPCNQFGHQESGTDEEIGQFCKLNYGVTFPVMKKVHVNGDNADPVYEYLKNEKAGMLGF
KGIKWNFEKFLIDKHGNVYERYSSLTKPANLDAKVQKLLGA
NT seq 486 nt   +upstreamnt  +downstreamnt
atgagcaaattctacgacctcgcacccctcgaccgcaccggcaagcccttccccttcaag
cagctggagggcaaggtggtgctcatcgtcaacgtcgcgtccaagtgcggcttcacgccg
cagtacgaggagctccaggagctctacaagcgctaccacgacaagggcttcgagatcatc
gggttcccctgcaaccagttcggccaccaggagagcggcacggacgaggagatcggccag
ttctgcaagctcaactacggcgtgacgttccccgtcatgaaaaaggtgcacgtcaacggc
gacaacgcggaccccgtgtacgagtacctcaagaacgagaaggccggcatgctgggcttc
aaaggcatcaagtggaacttcgagaagttcctcatcgacaagcacggcaacgtctacgag
cgctactcgtcgctgaccaagcccgccaacctggacgccaaggtccagaagctgctcggc
gcctga

DBGET integrated database retrieval system