KEGG   Lachancea thermotolerans: KLTH0H06600gHelp
Entry
KLTH0H06600g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H06600p
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00020  Citrate cycle (TCA cycle)
lth00620  Pyruvate metabolism
lth01100  Metabolic pathways
lth01200  Carbon metabolism
lth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0H06600g
   00620 Pyruvate metabolism
    KLTH0H06600g
Enzymes [BR:lth01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     KLTH0H06600g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATPgrasp_ST HlyD_D23 ATP-grasp_4 RnfC_N NQRA
Motif
Other DBs
NCBI-GeneID: 8294482
NCBI-ProteinID: XP_002556166
UniProt: C5E2P3
Position
H:580087..583611
Genome map
AA seq 1174 aa AA seqDB search
MSKLAGLRDSSNLLGEKNKLLVANRGEIPIRIFRSAHELSMKTVAIYSHEDRLSMHRLKA
DEAYMIGKEGKYTPVGAYLAIDEILKIAKEHNVDFIHPGYGFLSENSEFAQKVEAAGITW
IGPSAEVIESVGDKVSARNLAAKADVPVVPGTPGPIDSVEEAQAFVEEYGYPVIIKAAYG
GGGRGMRVVREGDDIADAFQRATSEAKTAFGNGTCFIERFLNKPKHIEVQLLADGYGNVV
HLFERDCSVQRRHQKVVEVAPAKTLPKDVRDAILTDAVKLAKVAGYKNAGTAEFLVDDQN
RHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLQELGLLQDKIITRGFAIQCRI
TTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGSIISPHYDSMLVKCSCSGSTYEI
VRRKMLRALIEFRIRGVKTNIPFLLTLLTNPVFIDGSYWTTFIDDTPELFKMVSSQNRAQ
KLLHYLADLAVNGSSIKGQMGLPKLHTQPSVPTLHDSNGEVIDVLTTPPPSGWRQVLLEQ
GPAQFAKAVRHYKGTLLMDTTWRDAHQSLLATRVRTYDLAAIAPTTAHALSGAFALECWG
GATFDVAMRFLHEDPWERLRILRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVEQAKE
NGVDIFRVFDALNDLEQLKVGVDAVKKANGVVEATICYSGDMLQPGKKYNLDYYLEITDK
IVQMGTHILGIKDMAGTLKPSAAKLLIGSIRAKYPDLPIHVHTHDSAGTAVASMAACAFA
GADVVDVATNSMSGMTSQPSINALLASLDGEIDTGVNVNMVRELDAYWAQMRLLYSCFEA
DLKGPDPEVYEHEIPGGQLTNLLFQAQQLGLGEKWAETKRAYRDANYLLGDLVKVTPTSK
VVGDLAQFMVSNKLTPDDVRRLASSLDFPDSVMDFFEGLIGQPYGGFPEPLRSDVLKNKR
RKLTCRPGLELAPFDLAGIKEDLQDRFGDIDECDVASYNMYPKVYEDFRKMRETYGDLSV
LPTKNFLSPPTVGEEIVVTIEKGKTLIIKPQAIGELNKETGLREVYFDLNGELRKVSVID
KSQKVDTLSKPKADAHDPFQIGAPMAGVIIEVKVHKGSLVKKGQPIAVLSAMKMEMVISS
PTDGQVKDVLVKDGENVDASDLLVFLEESVPPKE
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaactggcaggactgagagacagctcgaacctactaggtgagaaaaacaagctt
ctggttgccaacagaggtgagattcccatcagaatcttccgttcggcgcatgagctgtca
atgaagacggtcgctatctactcgcacgaggacagactgtcgatgcacagactcaaggca
gacgaggcgtacatgatcggcaaagaaggcaagtacacgcccgtgggcgcgtacctggca
atcgacgagatcttgaagatcgccaaagagcacaacgtggacttcatccacccggggtac
gggtttttgtctgagaactcggagttcgcgcagaaagtcgaggctgcagggatcacgtgg
atcggcccttcggcagaggtcatcgagtctgtgggtgacaaggtttctgcgagaaacctc
gctgccaaggccgacgtgcctgttgtgcctggtacgccgggccctattgactccgtggag
gaagcgcaggccttcgtcgaggagtacggatacccggtcatcatcaaggctgcctacggt
ggtggtggtagaggtatgagagtcgttcgcgagggcgacgacatcgccgacgcgttccag
cgtgccacctccgaagccaaaaccgccttcggaaacggaacctgtttcatcgagagattc
ctcaacaaacctaagcacattgaggtccaacttctcgctgatggatacggcaacgtcgtt
cacctgttcgagagagactgttccgtgcagagaagacaccagaaggtcgtggaagtcgct
cctgccaagaccttgcccaaggacgtgcgtgacgctattctaaccgatgccgtcaagctg
gcaaaggtcgcaggctacaagaacgcaggtactgctgagttcttggtcgacgaccagaac
agacactactttatcgaaatcaatccaagaatccaggttgagcacacaatcacagaggaa
atcaccggtatcgatatcgttgctgctcaaattcaaattgccgccggcgcttcgctgcag
gagctaggccttctgcaggacaaaatcattactcgtggtttcgccatccaatgtagaatc
accaccgaagaccccgccaagaactttcagccagataccggccgtattgaggtctaccgc
tctgcaggtggtaacggtgttagactggacggtggtaacgcctacgcgggctccatcatt
tcgcctcactacgattccatgttggtcaagtgctcttgctctggctctacttatgaaatt
gtccgtcgcaagatgttgcgtgccttgattgaattcagaatcagaggcgtgaagacaaac
attccatttttgttgactctgttgaccaaccccgtatttattgatggttcctattggacc
actttcattgacgacactcctgagttgttcaagatggtatcttctcagaaccgtgctcag
aagctcctgcactaccttgcagacttggctgtcaatggctcctctatcaagggtcaaatg
ggtctacctaagttgcacacgcagccatcagttccaaccctgcacgactctaacggagag
gtgatcgacgtcctcacaacccccccaccttcggggtggagacaagttttgctggaacaa
ggtccagctcagtttgccaaggctgttcgccactacaagggtactttgttgatggacact
acatggagagatgctcaccagtcgctgttggctactagagttcgtacctacgaccttgct
gccattgccccaactaccgcccatgctctgtctggcgctttcgcgcttgaatgttgggga
ggtgccactttcgacgtcgccatgagattcttgcacgaagacccatgggagcgtttgaga
attttgagaaagcttgttccaaacattccattccaaatgttgctgcgtggtgccaacggt
gtcgcttactcctcgctgcctgacaatgccatcgaccactttgtcgagcaagccaaggag
aacggagttgacattttcagagtgtttgacgctttgaacgacctcgagcagctcaaggtt
ggtgtcgatgctgtcaagaaggcgaatggtgtcgttgaagctaccatctgttactccggt
gacatgctgcagcctggaaaaaagtacaacttggactactacctagagattaccgacaag
atcgttcagatgggtactcacatcttgggtatcaaggatatggctggtacattgaagcca
tctgctgctaaattattgattggctccattagagccaagtacccagaccttccaatccac
gttcacactcacgactccgccggtaccgctgttgcttccatggctgcttgtgcctttgcc
ggtgctgatgttgttgatgtggccaccaactctatgtctggtatgacttcgcagccatcg
attaacgctttgctcgcgtctctagacggtgaaatcgacactggtgtgaacgtcaacatg
gtgcgtgagcttgacgcttactgggcgcaaatgagattgctctactcttgcttcgaggca
gacttgaagggcccagatccagaagtttacgagcacgaaattccaggcggacaactcacc
aacctgcttttccaggcccagcaattgggacttggagaaaaatgggctgaaaccaagagg
gcttacagagatgccaactacctgcttggcgacttggtgaaggtcactccaacctctaaa
gttgttggtgacttggcgcagtttatggtgtccaacaaattgactccagacgatgtcaga
cgtttggcatcctctttggacttcccagactctgttatggatttctttgagggtttaatc
ggacagccatacggtggcttccctgagccattgagatccgatgttttgaagaacaagaga
agaaagctgacttgccgtcccggtcttgagttggctccgttcgacctggccggaatcaag
gaagatcttcaagatagatttggcgacatcgacgaatgtgacgttgcgtcatacaacatg
tatccaaaggtttacgaagacttccgcaagatgagggaaacctacggtgatctgtcggtg
ctaccaaccaagaactttttgtctccaccaaccgttggcgaggaaattgttgtcaccatc
gagaagggtaagactctgatcatcaagcctcaggcgattggtgaactgaacaaggaaact
ggtttgagggaagtgtatttcgacctaaacggcgaattgagaaaggtttctgttattgac
aagtctcaaaaggttgacactttgtcgaagccaaaggctgatgcccacgatcccttccag
atcggcgcaccaatggcgggcgtcatcattgaagtcaaggttcacaagggttccttggtc
aagaagggtcaacctattgctgtcctgagtgccatgaaaatggaaatggttatctcctcc
cccacagacgggcaagtcaaggatgtgctagttaaggatggtgaaaatgtggacgcctct
gacctcctggtattcttagaggaatctgtcccaccaaaagaatag

DBGET integrated database retrieval system