KEGG   Leucobacter triazinivorans: EVS81_11160Help
Entry
EVS81_11160       CDS       T05843                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00051  Fructose and mannose metabolism
ltr00520  Amino sugar and nucleotide sugar metabolism
ltr01100  Metabolic pathways
ltr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EVS81_11160
   00520 Amino sugar and nucleotide sugar metabolism
    EVS81_11160
Enzymes [BR:ltr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     EVS81_11160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: QBE49324
UniProt: A0A4P6KIC5
Position
complement(2456067..2457197)
Genome map
AA seq 376 aa AA seqDB search
MTEASSSTPALESFTCVIPAGGVGSRLWPLSRANAPKFLLDLTGSGDSLLRATWDRLAPI
APPERVLVVTGVTHRDSVVDQLPELRSENLITESEPKDSSAAIGLAAALLELRDPDAILG
SFAADHVIRGDVLFQRAVTTAVQAADQGYIATIGIHPSHPATGFGYISCGRARGDLAPFD
VYDVTEFVEKPDAAQAGEYLAHGGYLWNAGMFIARATVLLDQMALAEPELVRSLREIAAT
WNTERGAEVRERLWPALPKIAIDYTVAEPAAAAGKMVCVAAHFDWDDVGDFASVANLLTR
GRGSDLAVLGDGAQVLSDASSGIVVSESDRLVALVGVEDVVVVDTADVLLVTSKSRAQDV
KNLVNRMKVTGGGHLL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcgagcagcagcaccccagcactcgagagcttcacgtgcgtgatcccggcc
ggcggcgtcggttcccgcctgtggccgctgtcgcgggccaacgccccgaagttcctgctc
gatctcaccggctcgggagactcgctgctgcgggccacgtgggatcgcctcgcccccatc
gcgcctcccgagcgcgtgctggtggtgaccggggtgacccaccgcgactcggtggtcgac
cagctgcccgagctccggtccgagaacctcatcaccgagagcgagccgaaggactcctcc
gcagcgatcggtctcgccgccgctctgctggagctgcgcgatcccgacgcgatcctcggc
tccttcgccgccgatcacgtgatccgcggcgacgtgctcttccagcgcgcggtgacgacg
gcggtgcaggccgccgaccaggggtacatcgcgaccatcggcatccacccgtcgcatccg
gccaccggcttcggctacatctcctgcggccgcgcgcgcggcgacctcgccccgttcgac
gtctacgacgtgaccgagttcgtcgagaagcccgacgccgcgcaggcgggcgagtacctg
gcgcacggcggctacctctggaacgcgggcatgttcatcgcccgcgcgacagtgctgctc
gaccagatggcactcgccgagcccgagctggtccgctcgctgcgcgagatcgctgcgacc
tggaacacggagcgcggcgccgaggtgcgggagcgcctgtggcccgcgctgccgaagatc
gcgatcgactacacggtcgccgagcccgcggcggcggcgggcaagatggtctgcgtcgcc
gcgcacttcgactgggacgacgtgggcgacttcgcgtccgtcgccaacctgctcacgcgc
ggccggggcagcgacctcgccgtgctcggcgacggggcccaggtgctctcggacgcgtcg
agcggcatcgtggtctccgagagcgaccgcctcgtggcgctcgtgggggtggaggacgtg
gtggtggtcgacacggccgacgtgctgctcgtcacgtccaagagccgggcccaggacgtc
aagaacctcgtgaaccggatgaaggtgaccgggggcggccacctgctctga

DBGET integrated database retrieval system