KEGG   Leucobacter triazinivorans: EVS81_11555Help
Entry
EVS81_11555       CDS       T05843                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00250  Alanine, aspartate and glutamate metabolism
ltr00330  Arginine and proline metabolism
ltr01100  Metabolic pathways
ltr01110  Biosynthesis of secondary metabolites
ltr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EVS81_11555
   00330 Arginine and proline metabolism
    EVS81_11555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ltr03000]
    EVS81_11555
Enzymes [BR:ltr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     EVS81_11555
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     EVS81_11555
Transcription factors [BR:ltr03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    EVS81_11555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: QBE49395
Position
complement(2557111..2560680)
Genome map
AA seq 1189 aa AA seqDB search
MSSRVAGTATRPQDLADEAVRLVQRWLREAAEVPADPSAERLAGVLRDPNGLDFTVGFVD
GVVRPEDLSAAAKKLNELTPLTPAFLPAPMRGAIGLGGALAKPLPGIVVPIARKVLRQMV
SHLIIDASDARLGPAIAKVTRDGVRLNINLLGEAILGQREAERRLAGTHALLARDDVDYV
SIKVSSTVAPHNHWAFDEAVAHIEEQLVPLFERANAASPKKFINLDMEEYKDLDLTIAVF
KRILERPEFAELEAGIVLQAYLPDALGAMIDLQEWAAARVSGGGAPIKVRIVKGANLPME
HVDAAIHGWPVATWGTKQDSDTSYKAVIDYALTPERVRNVRIGVAGHNLFDVALAWLLAK
ARGAQAGIEFEMLLGMATGQAEAVKREVGSLLLYTPVVHPQEFDVAIAYLIRRLEEGASQ
ENFMSAVFELNDSPALFEREKQRFLASLDDLSAITGDGTEASLRVPPPNRVQDRREYDEA
GAEARIEARIEAGRRGEFDNTADTDPDLPGNRAWGRGIASRMVDSRLGAELVASSRIGDE
AQLDAAVERGVAAADGWQALGTDERARILFRAGERLEARRAELLEVMGSECGKTLDQGDP
EVSEAIDFANYYAMLGQLLDRVDGAEFRRQKLIAVIPPWNFPVAIPAGGVLSALAAGSSV
IIKPAASSARSGAVMVEALWEAGVPRDVLQLVQFDERELGARLVGDRRVDRLILTGAYET
AVKFREFRSDLPILAETSGKNAVIVTPNADLDLAAKDVALSAFGHAGQKCSAASLVILVG
SVATSKRFRGQLLDAVRSLKVGTPEHLETQMGTVINAPDGKLLRGLTTLGPGEEWLIEPA
PVESDSPLARDAQGRSKLWSPGVRDGVRRGSEYHLTEYFGPILGIMTAETLDEAIDMVNE
IDYGLTSGLHSLDRDELALWLRRVEAGNLYVNRGITGAIVRRQSFGGWKKSAIGAGTKAG
GPNYLHGLGDWTDAPVAGELRAPRPAAAPLLTAAQQAGVAGAELDWLRAALGSDAAAWDD
EFGIARDASQLGVERNLLRYLPVPVTIRIAADAPLHRAVRAIAAGLAAGSTPAVSTPIAL
PQPLLAALAAAGVEVRFEDATAWAARVHQLAERRGPRAGGRIRIVAGASREDEAAAVVEA
SGGKPDIAVYAGEVVSAGRVEMLPHLREQAVSITAHRFGTPNRLSEGLI
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtcgcgtcgcaggcaccgccacccgcccccaggacctcgccgacgaggccgtc
cggctcgtgcagcgctggctgcgcgaagccgccgaggttcccgcggacccctcggccgaa
cgcctcgccggcgtgctgcgcgatccgaacggcctcgacttcaccgtcggcttcgtcgac
ggggtcgtgcgccccgaagacctgagcgcggcggcgaagaagctcaacgagctcaccccc
ctcaccccggcgttcctgcccgcgcccatgcggggcgcgatcggtctcggaggcgccctc
gcgaagcccctgcccggaatcgtggtgccgatcgcccgcaaggtgctgcggcagatggtg
agccacctcatcatcgacgcgagcgatgccaggctcgggccggcgatcgcgaaggtcacg
cgcgacggcgtgcgcctcaacatcaacctgctgggcgaggcgatcctcgggcagcgcgag
gccgagcgccgtctcgccgggacccacgcgctgctcgcccgcgacgacgtcgactacgtg
tccatcaaggtctcgtcgacggtggcgccgcacaaccactgggcgttcgacgaggccgtg
gcgcacatcgaggagcagctcgtgcccctcttcgagcgggcgaacgccgcctccccgaag
aagttcatcaacctcgacatggaggagtacaaggacctcgacctcaccatcgcggtcttc
aagcgcatcctcgaacgccccgagttcgccgagctcgaagccggcatcgtgctgcaggcg
tacctgccggacgcgctcggcgcgatgatcgatctgcaggagtgggccgcggcgcgcgtg
tcgggcggcggggcccccatcaaggtgcgcatcgtgaagggcgccaacctgccgatggag
cacgtcgacgccgcgatccacggctggccggtcgccacctggggcaccaagcaggattcg
gacacgagctacaaggccgtgatcgactacgcgctcaccccggagcgggtgcgcaacgtg
cgcatcggcgtcgcgggccacaacctcttcgacgtggccctcgcctggctcctcgcgaag
gcgcgcggggcgcaggccggcatcgagttcgagatgctgctcggcatggccaccgggcag
gccgaggccgtgaagcgcgaggtcggatccctgctgctctacacgccggtggtgcatccc
caggagttcgacgtggcgatcgcctacctgatccgccgcctcgaggagggggccagccag
gagaacttcatgtcggccgtgttcgagctgaacgacagccccgccctgttcgagcgcgag
aagcagcgcttcctcgcgtcgctcgacgatctctcggccatcactggtgacggcaccgaa
gcatcgctcagggtcccgccgccgaaccgggtgcaggatcggcgcgagtacgacgaggcc
ggcgccgaggcccgcatcgaggcgcgcatcgaagccggccgtcggggcgagttcgacaac
acggccgacaccgatcccgatctgcccgggaatcgcgcctgggggcgcgggatcgccagc
cgcatggtcgactcgcgcctcggcgctgagctcgtcgcctcgtcgcgtatcggcgacgag
gcgcagctcgacgcagccgtggagcgcggggtcgcggccgccgacggctggcaggcgctc
ggcaccgatgagcgcgcgcgcattctcttccgggccggcgagcgactcgaagcgaggcgc
gccgagctgctcgaggtgatgggctcggagtgcggcaagacgctggatcagggcgacccc
gaggtgtccgaggcgatcgacttcgccaactactacgcgatgctcggccagctgctcgac
cgggtcgacggcgcggagttccgccggcagaagctgatcgcggtcatcccgccgtggaac
ttccccgtggccatccccgccgggggcgtgctctcggcgctggctgcgggatcctccgtg
atcatcaagccggccgcgagctcggcgcgatcgggcgccgtgatggtcgaggcgctgtgg
gaggccggtgtgccccgcgacgtactgcagctcgtgcagttcgacgagcgcgagctcgga
gcgaggctcgtcggcgatcggcgcgtggaccgcctcatcctcaccggcgcgtacgagact
gccgtgaagttccgcgaattccgcagcgatctgccgatcctcgccgaaaccagcggcaag
aacgcggtgatcgtcaccccgaacgccgacctcgacctcgcggcgaaggatgtggcgctg
tcggcattcggtcacgccggacagaagtgctcagcggcctctctcgtgatcctcgtcggc
tccgtcgccacgtcgaagcgcttccgcggccagctgctcgacgccgtccgatcgctcaag
gtcggcacccccgagcacctcgagacccagatgggcacggtcatcaacgcccccgacggc
aagctgctgcgcgggctcacgacgctgggcccgggcgaggagtggctcatcgagcccgcg
cctgtcgagagcgacagcccgctggcgcgcgacgcgcagggcagaagcaagctctggagc
ccgggcgtgcgcgacggggtgcgacgcggatccgaataccacctcaccgagtacttcggc
ccgatcctcgggatcatgaccgcggagaccctcgacgaggcgatcgacatggtcaacgag
atcgactacggcctcacgagcggcctgcactccctcgaccgcgacgagctggccctgtgg
ctgcggcgcgtcgaggcgggcaacctgtacgtcaaccggggcatcaccggcgcgatcgtg
cgcaggcagtcgttcggcggctggaagaagtcggccatcggcgccggcaccaaggccggc
ggccccaactacctgcacggcctcggcgactggaccgacgcgcccgtcgcgggcgagctc
cgggcgccacggccggccgcggcgccgctgctcaccgcggcccagcaagccggcgtggcc
ggggcggagctcgactggctccgggccgcgctcggctcggacgccgcggcatgggacgac
gagttcgggatcgcgcgcgacgcctcccagctcggcgtggagcgcaatctgctgcgctac
ctgccagtgccggtgacgatccggatcgccgccgacgccccgctgcaccgcgccgtgcgc
gcgatcgcggcgggtctcgcggcgggatcgacgcccgcggtgagcacgccgatcgcactg
ccgcagccgctcctcgcggcgctcgccgcggccggcgtggaggtgcgcttcgaggacgcc
accgcctgggccgcgcgcgtgcaccagctcgccgagcgccgaggcccccgggccggcggg
cgcatccgcatcgtcgccggtgcatcgcgcgaggacgaggcggcagcggtcgtcgaggcc
tcgggcggcaagccggacatcgccgtctacgcgggagaggtcgtatcggccgggcgcgtg
gagatgctgccgcatctgcgggagcaggcggtctccatcacggcgcaccggttcggcacc
ccgaatcggctctcggagggcctcatctag

DBGET integrated database retrieval system