KEGG   Leucobacter triazinivorans: EVS81_11960Help
Entry
EVS81_11960       CDS       T05843                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00020  Citrate cycle (TCA cycle)
ltr00620  Pyruvate metabolism
ltr01100  Metabolic pathways
ltr01110  Biosynthesis of secondary metabolites
ltr01120  Microbial metabolism in diverse environments
ltr01130  Biosynthesis of antibiotics
ltr01200  Carbon metabolism
Module
ltr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ltr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EVS81_11960
   00620 Pyruvate metabolism
    EVS81_11960
Enzymes [BR:ltr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     EVS81_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Amino_oxidase
Motif
Other DBs
NCBI-ProteinID: QBE49463
UniProt: A0A4P6KGU9
Position
2654441..2655955
Genome map
AA seq 504 aa AA seqDB search
MSNNTVDVVLIGGGVMSATLGTLIKQVQPDWTIEIFESRSEVATESSNAWNNAGTGHAAL
CELNYMPEGADGSLSSAKAIDINEQFQLSRQWWSALVKQGILGEPSSFINATPHMTFVRG
EANVDYLRRRYELLKNEPLFADIEFSDDPAQIAEWAPLLVDRRAKDEVFAATRSESGTDV
DFGAVTRQLIRHLVSEGAELHLNAPVKQLKRRADGTWDVGVKAFSGAGYRTVNARFVFVG
AGGGALHLLQSSGIPEIKGFGGFPISGKFLKCDNPEIVAQHRAKVYGKAAVGAPPMSVPH
LDTRVVDGTESLLFGPYAGFSPNFLKHGSWWDLPGSIRPHNLGPMLKVGLTEFSLEKYLV
GEVLASREKQMSSLREYMPTARTEDWEMITAGQRVQVMKQDPEKGGILQFGTEVITGADG
SIAGLLGASPGASTAVHAMLGVLERCFPEQFEQWRPAFTQQVPAFGTGLNGDPEAAAASL
AETAAVLGLVPVAEPVAEPVAAEA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaacaacacggtagatgtcgtcctgatcggcggaggcgtgatgagcgccactctg
ggaacgctgatcaagcaggtgcagcccgactggacgatcgagatcttcgaatcccgatca
gaggtcgcgaccgagagcagcaacgcctggaacaacgcgggaaccggccacgccgcgctc
tgcgagctcaactacatgcccgagggcgcggacggcagcctgtcgtcggccaaggccatc
gatatcaacgagcagttccagctctcgcggcagtggtggtctgcactcgtgaagcagggc
attctcggcgagccgtcctcgttcatcaacgccacgccgcacatgaccttcgtgcgcggc
gaggccaatgtcgactacctgcgacgccgctacgagctgctcaagaacgagccgctcttc
gccgacatcgagttcagcgacgacccggcgcagatcgccgagtgggcgccgctgctggtc
gaccgccgcgccaaggacgaggtgttcgccgcgacccgttcggagagcggcaccgacgtc
gacttcggcgccgtcacccgtcagctgatccgccacctcgtttccgagggcgccgagctg
cacctcaacgcgccggtcaagcagctgaagcgccgcgccgacggcacctgggacgtgggc
gtgaaggccttctcgggtgcgggataccgcaccgtcaacgcccgcttcgtcttcgtgggc
gccggcggcggcgcgctgcacctgctgcagtcctcgggcatccccgagatcaagggattc
ggcggcttcccgatcagcggcaagttcctcaagtgcgacaaccccgagatcgtggcgcag
caccgggccaaggtctacggcaaggcagccgtgggtgcgccccccatgtcggtgccgcac
ctcgacacgcgcgtcgtggacggcacggagagcctgctcttcggcccctacgcgggcttc
agcccgaacttcctcaagcacgggtcgtggtgggatctgcccggctcgatccggccgcac
aatctcgggccgatgctcaaggtggggctcaccgagttctcgctcgagaagtacctggtc
ggcgaggtgctcgccagccgcgagaagcagatgagcagcctgcgcgagtacatgcccacc
gcgcgcaccgaggactgggagatgatcaccgcgggccagcgcgtgcaggtgatgaagcag
gatcccgagaagggcggcatcctgcagttcggtaccgaggtcatcacgggcgccgacggc
tccatcgccggtctgctcggcgcgtcgcccggcgcctcgacggccgtccatgcgatgctc
ggcgtgctcgagcgctgcttccccgagcagttcgagcagtggcggcccgccttcacacag
caggtgcccgcattcggcacgggcctcaacggcgatcccgaggcggcggccgcctcgctc
gccgagaccgccgcggtgctgggcctcgtgccggtcgccgagccggtcgcggagccggtg
gccgccgaggcctga

DBGET integrated database retrieval system