KEGG   Leucobacter triazinivorans: EVS81_13430Help
Entry
EVS81_13430       CDS       T05843                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00350  Tyrosine metabolism
ltr00360  Phenylalanine metabolism
ltr00380  Tryptophan metabolism
ltr01100  Metabolic pathways
ltr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    EVS81_13430
   00360 Phenylalanine metabolism
    EVS81_13430
   00380 Tryptophan metabolism
    EVS81_13430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ltr04147]
    EVS81_13430
Enzymes [BR:ltr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     EVS81_13430
    4.1.1.105  L-tryptophan decarboxylase
     EVS81_13430
Exosome [BR:ltr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EVS81_13430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: QBE49699
UniProt: A0A4V0Z1V2
Position
complement(2956771..2958228)
Genome map
AA seq 485 aa AA seqDB search
MTPEEFRAHGHQLIDWIADYRAGISKLPVLAQVEPGEVAAKLPASAPETGDAGRSLVSDL
DEIVVPGLSLWQHPGFFNFFPANSELSSVLGDIASAGLGVIGLSWESSPALSEIELRVTD
WVRQLFGLSGDWRGVIQDTASTSTLLALLEAREHASQFSMSGGGLAALDRPLVAYLSRYA
HSSVPKAALLAGFGTDHIRWIDTDETFAMRPDALAEAIAADRAAGRVPAAVVATCGTTTT
TAMDPLAAIGEIARAEGLWFHVDAAMAGSAMILPECRHLWEGVELADSLVVNAHKWLGVA
FDCSLYYVKDPAHLERVMSTNPSYLRSAHDDDVTNLRDWGIPLGRRFRALKLWFMLTAEG
AEALRARLRRDLDNAQWLTAQLEAEPGWRVLAPVHLQTVCVRHEPTGRDGGALSGEALDR
HTRAWAERVNATGRAWVSLSTIEDRWMVRISIGALETEREHVETLWQEMRAAVAEPSAPE
IRSRS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgaagagttccgcgcccacgggcatcagctcatcgactggatcgccgactac
cgcgcagggatctccaagctgcccgtgctggcgcaggtggaaccgggagaggtggcggcg
aaactgcccgcctccgccccggagaccggcgacgccgggcgatccctcgtctccgacctc
gacgagatcgtggtgccggggctgtcgctctggcagcaccccggcttcttcaacttcttc
ccggccaacagcgagctctcctcggtgctgggcgacatcgccagcgccggcctcggcgtc
atcgggctctcctgggagtcgagccccgccctctcagagatcgagctgcgggtgaccgac
tgggtacggcagctcttcgggctctccggcgactggcgcggcgtgatccaggacaccgcg
tcgacctccacgctgctcgccctgctcgaggcgcgcgagcacgcctcgcagttctcgatg
tccggcggcggcctggcggcgctcgaccgtcccctcgtcgcctacctgtcccgctatgcg
cactcctccgtgccgaaggcagccctgctggcgggcttcggcacggatcacattcgctgg
atcgacaccgacgagacgttcgccatgcgtccggacgccctcgcggaggccatcgccgcg
gatcgcgcggccggccgcgtccccgccgcggtggtggccacctgcggcaccacgacgacg
accgcgatggatccgctggccgcgatcggcgagatcgcacgggcggaggggctctggttc
cacgtcgacgccgcgatggccggctcggccatgatcctgcccgagtgccggcacctctgg
gagggcgtggagctggcggactcgctcgtggtcaacgcgcacaagtggctgggcgtggcg
ttcgactgctccctgtactacgtgaaggatcccgcgcatctcgagcgcgtgatgtcgacg
aacccctcgtacctgcggtcggcgcacgacgacgacgtgacgaacctgcgcgactggggg
attccgctgggccggcgcttccgcgcactcaagctctggttcatgctcacggccgagggt
gcggaggcgctgcgcgcccgcctacgccgggatctcgacaacgcgcagtggctcaccgcg
cagctcgaggcggagccgggctggcgcgtgctcgcgccggtgcacctgcagaccgtgtgc
gtgcggcacgagccgaccggccgcgacggcggcgcgctgagcggcgaggcgctcgaccgg
cacacccgcgcctgggccgagcgggtgaacgcgacgggccgggcctgggtgtcgctgtcg
acgatcgaggatcgctggatggtgcgcatctcgatcggtgcgctcgagaccgagcgcgag
cacgtcgagaccctgtggcaggagatgcgggccgcggtcgccgagccctcggcgccggag
atcagatcgcggtcgtga

DBGET integrated database retrieval system