KEGG   Lachnoanaerobaculum umeaense: D4A81_02775Help
Entry
D4A81_02775       CDS       T05639                                 

Definition
(GenBank) glycine--tRNA ligase
  KO
K01880  glycyl-tRNA synthetase [EC:6.1.1.14]
Organism
lua  Lachnoanaerobaculum umeaense
Pathway
lua00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lua00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D4A81_02775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lua01007]
    D4A81_02775
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lua03016]
    D4A81_02775
   03029 Mitochondrial biogenesis [BR:lua03029]
    D4A81_02775
Enzymes [BR:lua01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     D4A81_02775
Amino acid related enzymes [BR:lua01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   D4A81_02775
Transfer RNA biogenesis [BR:lua03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    D4A81_02775
Mitochondrial biogenesis [BR:lua03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D4A81_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HGTP_anticodon tRNA-synt_2b Ish1 Cytochrome_C7 GFA HypA
Motif
Other DBs
NCBI-ProteinID: AYA98945
UniProt: A0A385PYE1
Position
646451..647839
Genome map
AA seq 462 aa AA seqDB search
MEYSMEKIIALAKSRGFVYPGSEIYGGLANTWDYGNLGVELKNNVKAAWWQKFIKESPYN
VGVDCAILMNPQTWIASGHLGSFSDPLMDCKECHERFRADKIIEDYMQENNVSIDGSVDA
WSNDEMKKYIDEHEIACPTCGKHNFTDIRQFNLMFKTFQGVTEDAKNVVYLRPETAQGIF
VNFKNVQRTSRKKVPFGIGQIGKSFRNEITPGNFTFRTREFEQMELEFFCKPGTDLEWFE
YWRGFCRDWLIALGIKEEQMRLRDHDKEELSFYSNATTDIEFLFPFGWGELWGIADRTDY
DLGRHQEVSGQDLTYFDDETSERYIPYVVEPSLGADRVTLAFLCAAYDEETLEGGDTRTV
LHFHPALAPVKIGILPLSKKLNEGALKISEELSKYYNVEFDDRGNIGKRYRRQDEIGTPF
CITYDFDSENDNAVTVRDRDSMEQVRIPIAELKAYFEDKFRF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggaatatagcatggaaaaaatcatagcactggcaaaatcaagaggatttgtatatccg
ggttcagagatatacggtggtcttgcaaatacctgggactatggtaacttgggtgttgaa
ttaaagaataatgttaaagctgcctggtggcagaagtttataaaggagtcaccatacaat
gtaggtgttgactgtgccattttgatgaatccacagacatggatagcatcaggacatttg
ggaagcttttcagatcctcttatggactgtaaggaatgccatgagagatttagagcggac
aagatcattgaggactatatgcaggaaaataatgtttctatagacggtagcgtggatgca
tggtcaaatgatgagatgaaaaagtacattgatgagcatgagatagcttgtccaacctgt
ggtaagcacaattttacagatatccgtcagttcaatcttatgtttaagactttccagggt
gtaacagaggatgctaaaaatgtggtttatttaagacccgaaacagcacagggtattttt
gtaaactttaagaatgtacaaagaacttcaagaaagaaagtaccttttggtataggacag
attggtaagtcattcagaaatgagatcactccgggtaacttcacatttagaacaagagag
tttgagcagatggagcttgagttcttctgtaagccgggtacagaccttgagtggtttgag
tattggagaggtttctgtagagattggcttatagctcttggtatcaaagaggagcagatg
agacttagagaccatgacaaagaggagcttagtttctattcaaatgctacaacagatata
gaattcctcttcccattcggttggggtgagctttggggaatcgcagacagaacagattat
gatcttggtcgtcatcaggaagtttcaggacaggatcttacatattttgatgatgagaca
agtgagagatacattccatatgtagtagagccttcacttggtgcagacagagttacttta
gcattcctttgtgcggcatatgatgaagagactcttgagggcggtgatacaagaacagtt
cttcacttccatcctgcacttgctcctgttaagatcggtattttaccgctttcaaagaag
cttaatgagggtgctcttaagatatctgaagaattatcaaagtattacaatgtagagttt
gatgacagaggaaatatcggtaagagatatcgtagacaggatgaaataggtacaccattc
tgtattacatatgactttgactctgagaatgataatgctgtaactgtaagagatagagac
agtatggagcaggtaagaatcccgatagcagagcttaaggcttattttgaggacaaattt
agattttaa

DBGET integrated database retrieval system