KEGG   Lachnoanaerobaculum umeaense: D4A81_03240
Entry
D4A81_03240       CDS       T05639                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
lua  Lachnoanaerobaculum umeaense
Pathway
lua00230  Purine metabolism
lua01100  Metabolic pathways
lua01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lua00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    D4A81_03240
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AYA99026
UniProt: A0A385PYK2
Position
732462..732953
AA seq 163 aa
MTGQSYKLVTCTINGKKCEKMVDVRSSLTDMLRNDYRLTSVKKGCEVGECGACNVLIDGE
AFNSCIYLAVWAEGKDILTLEGLMGPNGEISDLQQAFIDETAVQCGFCTPGFVMSATEIL
NSGKLYTKAELRKLLSGHLCRCTGYENILVAVEKTMKKRLGVD
NT seq 492 nt   +upstreamnt  +downstreamnt
atgacaggacagagttataaattggtaacttgcactatcaatggcaagaaatgtgagaaa
atggtagatgtaagaagctcacttacagatatgcttagaaatgactacagacttacttct
gtaaaaaagggttgcgaagtaggagagtgcggagcatgtaatgtacttatagatggcgag
gcgtttaactcttgtatttatctggcagtgtgggctgagggcaaggatatccttacattg
gaaggtcttatgggaccaaatggcgagatttcagatttgcaacaggcatttatagatgaa
acagcagtacagtgtggtttctgtactccgggatttgtaatgtcagctactgagattctt
aacagtggaaagctttatacaaaggcagaacttagaaagttgctttcaggacatctttgc
agatgtacaggatatgaaaacatacttgtagctgttgaaaagacaatgaagaagagactt
ggggttgactaa

DBGET integrated database retrieval system