KEGG   Lachnoanaerobaculum umeaense: D4A81_12085Help
Entry
D4A81_12085       CDS       T05639                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lua  Lachnoanaerobaculum umeaense
Pathway
lua00480  Glutathione metabolism
lua00590  Arachidonic acid metabolism
lua01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lua00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    D4A81_12085
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    D4A81_12085
Enzymes [BR:lua01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     D4A81_12085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AYB00599
UniProt: A0A385Q2I7
Position
complement(2579752..2580297)
Genome map
AA seq 181 aa AA seqDB search
MNIYDFKVKNNKGEEVSLSDYKNKVVLIINSATECGFTPQYEQLQKLYADYQDKDFVILD
FPCNQFGHQAPGSDEEIAKFCSSRFGVTFPLFSKIEVNGDGASEVFKYLKSEKGFAGWGA
DNDMSKLLTKMLSEVDPDYASKPDIKWNFTKFLIDKSGNVVRRFEPTEGVEVVEEAVKEL
I
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatatgattttaaagtaaaaaacaacaagggtgaggaagttagccttagcgat
tataagaacaaggtagtacttataataaactctgcaacagagtgtggatttacaccacaa
tatgagcagttacaaaagctttatgcagactatcaggacaaggacttcgttatacttgat
ttcccatgcaatcagttcggacatcaggcaccgggaagtgatgaggagattgctaagttt
tgcagctcaagattcggtgtaaccttcccattgttctcaaaaatagaagtaaatggtgac
ggtgcaagtgaagtatttaagtatcttaagagtgagaagggctttgcaggatggggagct
gataatgatatgtcaaagcttcttacaaagatgcttagtgaggtagatcctgactatgca
agcaagcctgatattaagtggaactttacaaaattccttatagacaagagtggaaatgtt
gtaagaagatttgagcctacagaaggtgttgaagtagtagaagaggctgtaaaagaatta
atttaa

DBGET integrated database retrieval system