KEGG   Luteimonas sp. 83-4: DCD74_08515Help
Entry
DCD74_08515       CDS       T05527                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
lue  Luteimonas sp. 83-4
Pathway
lue00520  Amino sugar and nucleotide sugar metabolism
lue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lue00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DCD74_08515
Enzymes [BR:lue01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     DCD74_08515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AXA84727
UniProt: A0A344J6R7
Position
complement(1764798..1765745)
Genome map
AA seq 315 aa AA seqDB search
MLNAGRVLVTGGAGFLGSHLCDRLVAAGHDVLCVDNFYTGNKDNVRDLIGRPNFELMRHD
VTFPLYVEVDRIYNLACPASPVHYQSDPVQTTKTSVHGAINMLGLAKRVRARILQASTSE
VYGDPEVHPQPEAYWGRVNPIGIRSCYDEGKRCAETLFFDYWRQHRLEIKVMRIFNTYGP
RMHPNDGRVVSNFIVQALRGQPITIYGDGTQTRSFCYVDDLIEGMTRLMDSRAEFTGPVN
IGNPGEFTMLELAETVVSLVGGKSGIVHQPLPEDDPKQRKPDIGLAERKLGWAPTVSLQD
GLKETIAYFRRRLEL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacgcgggaagggttttggtgacgggcggggcgggattccttggttcgcacttg
tgcgacagactggtcgctgcagggcacgacgtgctgtgcgtggataacttctacacgggc
aacaaagacaacgtgcgtgacctgattgggcgcccgaatttcgagctgatgcgccacgac
gtgacgttcccgctctacgtggaagtcgatcggatctacaacctggcatgcccggcgtcg
ccggtccactaccagtcggatcctgtgcagacaaccaagaccagcgtgcacggtgcgatc
aacatgctcggcctggcaaaacgcgttcgtgcgcggatcctgcaggcaagcacgagcgag
gtctacggcgaccccgaagtgcacccgcagcccgaggcctattggggaagggtcaacccg
atcggaatccgcagctgctacgacgaaggcaagcgttgcgccgagacgcttttcttcgac
tactggcggcagcatcggctggagatcaaggtcatgcggatcttcaacacgtacggcccg
cgcatgcatcccaatgacggccgggttgtcagcaacttcatcgtgcaggcacttcgtggt
cagcccatcacgatatacggggacggcacccagacccgcagcttctgctacgtggacgac
ctcatcgaaggcatgacccgcctgatggacagccgcgctgaattcaccggtccggtcaat
atcggcaatcccggcgagttcaccatgctggaacttgcagagaccgtggtctcgctggtg
ggtggcaagtccggcatcgtccaccagccccttccggaagacgaccccaagcaacgaaag
ccggacatcggcttggctgagcgcaaactcggctgggctcccacagtttcgctgcaggac
gggctcaaggagaccatcgcgtatttccggcggcgtctggagctttga

DBGET integrated database retrieval system