KEGG   Luteimonas sp. 83-4: DCD74_10085Help
Entry
DCD74_10085       CDS       T05527                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lue  Luteimonas sp. 83-4
Pathway
lue00360  Phenylalanine metabolism
lue00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lue00790  Folate biosynthesis
lue01100  Metabolic pathways
lue01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DCD74_10085
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DCD74_10085
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DCD74_10085
Enzymes [BR:lue01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DCD74_10085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AXA84981
UniProt: A0A344J7H1
Position
2093238..2094128
Genome map
AA seq 296 aa AA seqDB search
MNSTPRRVENVVTDKGKVPMYATGIVEQPWDDYSEADHDVWRQLYDRQRQLLIGRASDEF
LAAQDAMGMTPDRIPKFSELNTVLKAATGWEIIGVEGLLPELDFFDHLANRRFPVTWWIR
RPDQIDYIEEPDLFHDLFGHVPLLMLPVFADYMAAYGRGGVKAHGIGPEALVNLTRLYWY
TVEFGLIRQKDGLRIYGSGIVSSKGESLHSLESATPNRMGFDLERIMRTRYRIDSYQKTY
FVIDSFQQLMDATLPDFTPIYARLSEQEAVPAGTVLVTDEVITRGSGEGWPDDADV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcacaccccgccgcgtcgagaacgtcgtcaccgacaagggcaaggtgccgatg
tatgccaccggcatcgtcgagcagccctgggacgattacagcgaagccgaccacgatgtc
tggcgccagctctacgaccgccagcgccagttgctgatcggccgcgccagcgacgaattc
ctggccgcgcaggacgcgatgggcatgacgcccgaccgcatcccgaaattctccgagctc
aacaccgtgctgaaggccgccaccggctgggaaatcatcggcgtcgaggggctgctgccg
gagctggatttcttcgaccacctggccaaccggcgtttcccggtgacctggtggatccgt
cggcccgaccagatcgactacatcgaggaacccgacctcttccacgacctgttcggccac
gtgccgctgctgatgctgccggtgttcgccgactacatggccgcctacgggcgcggcgga
gtcaaggcgcacggcatcgggccggaggcgctggtcaacctgacccgcctttactggtac
acggtggaattcgggctgatccggcagaaggacggcctgcgcatctacggcagcggcatc
gtgtcgtcgaaaggcgaatcgttgcattcgctggaatcagccacgcccaatcgcatgggt
ttcgacctcgagcggatcatgcgcacgcgctaccgcatcgacagctaccagaagacctat
ttcgtcatcgacagcttccagcagttgatggatgccacgctgcccgacttcaccccgatc
tacgcgcgcctgtccgaacaggaggccgtgcccgccggcaccgtgctggtgaccgacgag
gtgatcacccgcggcagcggcgaaggctggccggacgacgcggacgtctaa

DBGET integrated database retrieval system