KEGG   Luteimonas sp. 83-4: DCD74_10835Help
Entry
DCD74_10835       CDS       T05527                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
lue  Luteimonas sp. 83-4
Pathway
lue00780  Biotin metabolism
lue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lue00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DCD74_10835 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lue01007]
    DCD74_10835 (bioF)
Enzymes [BR:lue01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     DCD74_10835 (bioF)
Amino acid related enzymes [BR:lue01007]
 Aminotransferase (transaminase)
  Class II
   DCD74_10835 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 FBPase_glpX Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AXA85110
UniProt: A0A344J7V0
Position
complement(2248078..2249274)
Genome map
AA seq 398 aa AA seqDB search
MRPSLRDRILEARKQRDDRRRRRHRQSIQRRDGVHLEIDGRWLTGFCSNDYLGLSQHFSV
IGALQDEAARSGAGGVSSHLVCGHMAIHDALEREVADWLQVPAALAFSSGWAGNLAVVQA
MLGEGDVCVQDRLNHASLLDATRLASCHLRRYPHGDVEGALRQLRTHPDGAAMIATDGVF
SMDGDLAPLRDLALAAMVQRATLYVDDAHGIGVVGPEGRGSVAAARLTVKEVPLQLATLG
KALGSFGAVVAGEADYVAHLAETARPYLYTTALTPAQAAASLAAVKLARREHWRREKLLA
LTLRFRAAALRNGFALLDSDTPIQPLVCGTAAHALAMADALRDEGFLTVAIRPPTVPENT
ARLRITLSALHTPEDIDALVDALCRARDETRRRVGTPL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccttcgctgcgcgatcgcatcctggaagcgcgcaagcagcgcgacgaccggcgc
cgccgccggcatcgccaatccatccagcgccgcgacggcgtgcatctggaaatcgacggc
cgctggctgaccggtttctgcagcaacgactacctgggcctgtcgcagcatttttcggtg
atcggcgccctgcaggacgaggccgcgcgctccggcgccggcggcgtgtcctcgcacctg
gtctgcggccacatggccatccacgatgcgctggaacgcgaagtcgccgactggctgcag
gtgccggcggcgctggcgttctccagcggctgggccggcaacctggcggtggtgcaggcg
atgctgggcgaaggcgacgtctgcgtgcaggaccgcctcaaccacgccagcctgctcgat
gccacccgcctggccagctgccacctgcgccgctatccgcatggcgatgtcgaaggcgcg
ttgcgccagttgcgcacccatcccgatggcgcggcgatgatcgccaccgacggcgtcttc
agcatggacggcgacctcgcgccgctgcgcgacctcgcgctggccgcgatggtccagcgc
gcgacgctgtatgtcgatgacgcgcacggcatcggcgtggtcggcccggaggggcgcggc
agcgtggcggccgcgcggctgacggtgaaggaagtaccgctgcagctggccacgctcggc
aaggcgctcggcagcttcggcgcggtggtggcgggcgaggccgattacgtcgcgcatctc
gccgaaaccgcgcgtccgtatctctacaccaccgcgctcaccccggcacaggccgcggcc
tcgctggcggcggtcaagctggcccggcgcgaacactggcgccgcgaaaaactgctggcg
ctgaccctgcgcttccgcgccgccgcgctccgcaatggcttcgccctgctcgattccgac
acgccgatccagccgctggtctgcggcaccgccgcgcatgccctggcgatggccgacgcg
ctgcgcgacgaaggcttcctgaccgtcgccatccgcccgccgaccgtgccggaaaacacc
gcgcgcctgcgcatcacgctttccgcgctgcacacgccggaagacatcgacgcgctggtg
gacgccctctgccgcgcccgcgacgaaacccggcgccgcgtcggcaccccgctgtga

DBGET integrated database retrieval system