KEGG   Luteimonas sp. Gr-4: FPZ22_01255Help
Entry
FPZ22_01255       CDS       T06154                                 

Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
lug  Luteimonas sp. Gr-4
Pathway
lug00230  Purine metabolism
lug00240  Pyrimidine metabolism
lug01100  Metabolic pathways
lug01110  Biosynthesis of secondary metabolites
Module
lug_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
lug_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
lug_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:lug00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FPZ22_01255
   00240 Pyrimidine metabolism
    FPZ22_01255
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lug04131]
    FPZ22_01255
Enzymes [BR:lug01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     FPZ22_01255
Membrane trafficking [BR:lug04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    FPZ22_01255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK CCDC23
Motif
Other DBs
NCBI-ProteinID: QDW65692
UniProt: A0A518N1A6
Position
complement(273201..273626)
Genome map
AA seq 141 aa AA seqDB search
MALERTLSIIKPDAVAKNVIGEIYSRFEKAGLKVAAAKMKQLSRAEAEGFYAVHRERPFF
NALVEFMISGPVMIQVLEGEGAVLKNRELMGATNPKEAAAGTIRADFADSIDANAVHGSD
AAETAAVEIAYFFPSTDVYAR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggagcgcaccctgtccatcatcaagcccgatgccgtcgccaagaacgtcatc
ggcgagatctattcccgtttcgagaaggccggcctcaaggtcgccgccgcgaagatgaag
cagctctcgcgcgccgaggccgaaggcttctacgccgtgcaccgcgagcgccccttcttc
aacgccctggtggagttcatgatcagcggcccggtgatgatccaggtcctggaaggcgag
ggcgcggtgctgaagaaccgcgagctgatgggcgccaccaacccgaaggaagccgccgcc
ggcaccatccgcgcggacttcgccgactcgatcgacgccaacgccgtgcacggctccgac
gccgccgagaccgccgccgtcgagatcgcgtacttcttcccgtcgacggacgtctacgcg
cgttga

DBGET integrated database retrieval system