KEGG   Lutibacter sp. LPB0138: LPB138_01570Help
Entry
LPB138_01570      CDS       T04497                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00625  Chloroalkane and chloroalkene degradation
lul01100  Metabolic pathways
lul01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LPB138_01570
   00361 Chlorocyclohexane and chlorobenzene degradation
    LPB138_01570
Enzymes [BR:lul01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LPB138_01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like NIF
Motif
Other DBs
NCBI-ProteinID: AOW19452
UniProt: A0A1D8P4F1
Position
complement(309847..310464)
Genome map
AA seq 205 aa AA seqDB search
MNSKIDTIIFDLGGVLVDWNPQYLYEKIFSTQEEIDWFLNNVCTPDWNIEQDAGRTIAEA
NTIKIKEFPKYSNEIKLFYDRWEEMFSGPIHKSVEIQQKLLKSPNYRVYALTNWSAETWD
RGRNLFPFLNDFEGVIVSGQEKMRKPYDEIYQLIINRFNITPENSVFIDDNYENTVAATK
NGINSIHFKTSEKLLIDLQKLNVII
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaactctaaaatcgacacaattatatttgacttaggtggtgtactagtagattggaat
cctcaatatttatatgaaaaaatattttcaactcaagaggaaatagactggtttcttaat
aatgtatgcactcctgactggaatatagagcaagatgctggaagaactattgcagaagca
aatacaattaaaataaaagaatttccaaaatattcaaatgaaataaaactattttatgat
agatgggaagaaatgttttctggtccaattcataaaagtgttgaaatacaacaaaaacta
ttaaaatctcctaattacagagtatatgcgcttactaattggagtgcagaaacctgggat
agaggacggaatttatttccatttttaaatgattttgaaggtgtaattgtttctggacaa
gaaaaaatgagaaaaccatatgatgaaatatatcaattaattattaatagatttaatatt
acacctgaaaattctgtttttattgatgataattatgaaaatacagtagctgcaacaaaa
aatggcataaactcaattcactttaaaacttcagaaaaactacttatagatcttcaaaaa
ttaaatgtaattatctaa

DBGET integrated database retrieval system