KEGG   Lutibacter sp. LPB0138: LPB138_07455Help
Entry
LPB138_07455      CDS       T04497                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00010  Glycolysis / Gluconeogenesis
lul00020  Citrate cycle (TCA cycle)
lul00620  Pyruvate metabolism
lul01100  Metabolic pathways
lul01110  Biosynthesis of secondary metabolites
lul01120  Microbial metabolism in diverse environments
lul01130  Biosynthesis of antibiotics
lul01200  Carbon metabolism
Module
lul_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPB138_07455
   00020 Citrate cycle (TCA cycle)
    LPB138_07455
   00620 Pyruvate metabolism
    LPB138_07455
Enzymes [BR:lul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     LPB138_07455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: AOW20521
UniProt: A0A1D8P7J4
Position
complement(1627904..1629523)
Genome map
AA seq 539 aa AA seqDB search
MMNHELISKTISLKKYGIKNAIINYNLSPEKLHDICIEKGLGVKTYSGALAINTGEFTGR
SPLDRFIVQDEITKDKVWWGDINIPFDSNRFDKLYDKVTKYLSDKELYVRDAYACADDKY
RMNIRVINELPWSNIFAYNMFLRPTTEELDDFNPEWTIINAPNFMADAEIDGTRQHNFAI
LDFSKKVVLIGGTGYTGEMKKGIFSALNFILPVYKETLPMHCSANVGENGETAIFFGLSG
TGKTTLSADPKRKLIGDDEHGWTKDNTIFNFEGGCYAKVINLSKENEPDIFDAIKSGSLL
ENVIFKNGTNEVDFSDISITQNTRVSYPINHIKNIQKPSLGKNPKNIFFLTADAFGVLPP
ISRLLPNQAAYHFISGYTAKVAGTEAGVTEPIPSFSACFGAPFMPLHPAKYAEMLSTKMK
EANVNVWLVNTGWTGGPYGIGTRIKLKYTRAMINAALNGDLGTYNYKDYHIHSVFGVAQP
RECPGVPKSVLSPRATWNNDEAYYKMAFKLSNAFRENFDQFESIANEEIRRGGPQRFAF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaccacgaactaatttcgaaaacgatttcgcttaaaaagtatggtattaaaaat
gctataattaattataatttatcgccagaaaaacttcatgatatttgcattgaaaaagga
ttgggtgtaaaaacctattcaggtgctttggcaattaatactggtgagtttacaggccga
tcaccactcgatagatttattgtacaagacgaaataacaaaggataaggtttggtgggga
gatataaatataccttttgattcaaataggtttgataaattatatgataaagttactaag
tatctttctgataaagaactttatgtaagagatgcttatgcttgtgcagacgacaaatat
cgaatgaatattcgtgttattaatgaattaccttggtcaaatatatttgcatataatatg
tttcttagaccaactactgaagaacttgatgattttaatccagaatggactataattaat
gctcctaattttatggctgatgctgaaattgatggtactcgtcagcataacttcgctata
ctagatttctctaaaaaagttgtgctaattggtggtacaggatacactggtgaaatgaaa
aaaggtattttttcggcattgaattttattcttccagtttataaagaaacattgccaatg
cattgttctgcaaatgtaggagaaaatggagaaacggcaattttctttgggctttcagga
actggaaaaacaactttgtctgctgatccaaaaagaaaattaattggtgatgatgaacat
ggatggactaaggataatacaatttttaattttgaaggtggttgttatgctaaagtgatt
aatttatcaaaagaaaatgaaccagatatttttgatgcaataaaatcaggttccttattg
gagaatgttatatttaagaatggaacgaatgaagtagatttttctgatatatcaattact
caaaatactagagtaagttaccctataaatcatataaaaaatattcaaaaaccttcatta
gggaaaaatcctaagaatatatttttcttaacggctgatgcttttggtgttttacctcca
atttcgagattacttcctaatcaagcagcctatcattttatatctggttatacagcaaaa
gttgcgggaacagaggctggagtaacggaaccaataccttctttctcagcatgttttggt
gccccatttatgccacttcatcctgcgaaatatgccgaaatgctaagtactaagatgaaa
gaagctaatgtgaatgtgtggctagtaaatactggttggacaggtggaccatatggaata
ggaactagaatcaagttgaaatatacccgagcaatgattaatgctgcactaaacggagac
ttaggtacttataattataaagattatcatattcattcagtatttggagttgctcaacct
agagagtgtccaggtgtgccaaaatctgtattaagtccacgagcaacatggaataatgat
gaggcttattataaaatggcttttaaattgtcaaatgcatttagggaaaattttgaccaa
tttgaatcaattgccaacgaagaaattagaagaggagggcctcaaagatttgctttttaa

DBGET integrated database retrieval system