KEGG   Lutibacter sp. LPB0138: LPB138_09585Help
Entry
LPB138_09585      CDS       T04497                                 

Definition
(GenBank) phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00030  Pentose phosphate pathway
lul00480  Glutathione metabolism
lul01100  Metabolic pathways
lul01110  Biosynthesis of secondary metabolites
lul01120  Microbial metabolism in diverse environments
lul01130  Biosynthesis of antibiotics
lul01200  Carbon metabolism
Module
lul_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lul_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LPB138_09585
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LPB138_09585
Enzymes [BR:lul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     LPB138_09585
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     LPB138_09585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AOW20907
UniProt: A0A1D8P8K5
Position
2124994..2126403
Genome map
AA seq 469 aa AA seqDB search
MSQKNYDFGLVGLGVMGRNFILNVADNNFSAFGHDLDEEKVNSLIQEGGDTSRVYASTDA
KTFVNALSSPRKIMLLVPAGKVVDIVIEGLLPMLDKGDIIIDGGNSFYTDTDRREAYLKE
KGIHFFGSGVSGGAKGARKGPSIMPGGDREAYKEVKPIFEAVSAKFKGEPCVAYLGNKSA
GNYVKMVHNGIEYGMMQLTSEIYDLLKKAGGLSNEELHNVYTEWNNGRLQSFLVQITSEI
FAQKDDKTDGMLVDKILDKAKQKGTGKWTSQNAMDLGIPVPTIDIAVSMREISALKEERI
QADALYGRPTPAPIDKNELIKMAEEALYFAFINAYAQGLAQLTDASKEYNYELDLSVIAK
IWRAGCIIRAELLEDISKAYVANKDLKNLLLSPLFVDKVQSTVPSARALVSYAAKSGIPV
PGLSNSLTYFDAYTSSRLPLNLIQAQRDHFGSHTYERIDMEGIFHTEWE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaaaaaattatgacttcggattggtaggtcttggagtaatgggacgtaacttt
attttgaatgtagcagacaataatttttctgcttttggtcacgacttagatgaagaaaaa
gtaaattctttaattcaagaaggtggagatacatcaagggtgtatgcctcgacagatgca
aaaacttttgtaaatgcattgagttcaccaagaaaaataatgttattagttccggctgga
aaagttgtagatattgttattgaaggattactcccaatgttagataaaggagatataatt
atcgatggaggaaattcattctatacggatacagatcgacgtgaggcatatttaaaagaa
aaaggaattcacttttttggctcaggtgtttctggaggcgcaaaaggagcaagaaagggg
ccaagtatcatgcctggaggtgatcgagaagcttacaaagaagttaaacctattttcgaa
gcagtttctgcaaaatttaaaggagagccttgcgttgcatatcttggaaataaatctgca
ggaaactatgtgaaaatggttcacaatggtattgaatatggaatgatgcaattaacatct
gagatatatgatttacttaaaaaagcaggaggattatcaaacgaagaattacataatgtt
tatacagaatggaataacggtcgcttacaatctttcttagttcaaattacttcagaaata
ttcgctcaaaaagacgataaaactgacggaatgttagttgataaaatcttagataaagcc
aaacaaaaaggtactgggaaatggacatcacaaaacgcaatggatcttggaattcctgtt
ccaactattgatattgcggtaagtatgcgtgaaatatctgcattgaaagaagagagaatt
caagcagatgctttatacggaagacctactccagcaccaattgataaaaatgaactgatt
aaaatggcagaagaagcattgtatttcgcttttattaatgcatatgcacaaggtttggct
caattaactgatgcctcaaaagaatataattacgaattagatttatctgtcattgcaaaa
atatggagagcaggatgtatcatccgtgcagaattacttgaagatatttctaaagcatat
gttgcaaacaaggatttgaaaaacttattgttatcaccattattcgtggataaagtacaa
tcaacagttccatcggcaagagcattggtttcttatgctgctaaaagtggaattccagtt
ccaggactttcaaattcactaacttattttgatgcttatacatctagtagattacctttg
aatttaattcaagcacaaagagatcattttggatctcatacttatgaaagaatagatatg
gaaggtattttccatactgaatgggaatag

DBGET integrated database retrieval system