KEGG   Luteimonas sp. 100111: CNR27_02595Help
Entry
CNR27_02595       CDS       T05077                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
lum  Luteimonas sp. 100111
Brite
KEGG Orthology (KO) [BR:lum00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lum03016]
    CNR27_02595
Enzymes [BR:lum01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CNR27_02595
Transfer RNA biogenesis [BR:lum03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    CNR27_02595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ATD68649
UniProt: A0A290XHW0
Position
559988..560674
Genome map
AA seq 228 aa AA seqDB search
MIEVRYADEWLAVVDKPAGLMVHDSALARDEHDFLADRLREQFGRPLFLIHRLDRATSGG
LLVAFDRETASALGAQWMARTVDKHYLAICRGWPDDIVVDHPLDGGPGKPVKKPAITRFT
RLATTELALPSSGFATSRYALLRAEPMTGRFRQIRRHLKHLSHHLIGDTSHGDGRHNRNF
RMLGIHRMLLHAERVGFDHPRTGQRLVVETPPGDEFAKALLLFPGVPA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggtgcgctacgcggacgaatggctggcggtcgtggacaagccggcgggcctg
atggtccacgacagcgccctggcccgggacgagcacgacttcctcgccgaccgcctgcgc
gagcagttcggccggccgctgttcctgatccaccggctggaccgggcgaccagcggcggc
ctgctggtggccttcgaccgcgagaccgcgtccgcgctcggcgcccagtggatggcgcgc
acggtcgacaagcactacctcgcgatctgccgcggctggccggacgacatcgtggtcgac
catccactcgatggcggccccggcaaaccggtgaaaaagccggcgatcacccgcttcacc
cgcctggcgacgaccgaactggcattgccgtcatcggggtttgcgacctcgcgctacgcc
ctgctgcgcgcagagccgatgaccgggcgtttccgccagatccgccggcacctcaagcac
ctctcgcaccatctgatcggcgacaccagtcacggcgacggccgccacaatcgcaacttc
cgcatgctcggcatccaccgcatgctgctccacgccgagcgcgtgggcttcgaccacccc
aggacgggccagcggctcgtggtcgagacgccgcctggcgacgaattcgccaaggccctg
ctgctctttcccggggtgccggcctag

DBGET integrated database retrieval system