KEGG   Luteimonas sp. 100111: CNR27_02905Help
Entry
CNR27_02905       CDS       T05077                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00620  Pyruvate metabolism
lum00630  Glyoxylate and dicarboxylate metabolism
lum01100  Metabolic pathways
lum01110  Biosynthesis of secondary metabolites
lum01120  Microbial metabolism in diverse environments
lum01200  Carbon metabolism
Module
lum_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNR27_02905
   00630 Glyoxylate and dicarboxylate metabolism
    CNR27_02905
Enzymes [BR:lum01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CNR27_02905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ATD66532
UniProt: A0A290XBK2
Position
638125..639861
Genome map
AA seq 578 aa AA seqDB search
MLSIDITGLSNSRAGRTVGNTRSAERDKDPQPVNAVIKTAPSADAPRFTLPADTATDLLD
APALAFLAELHQRFEPRRRALLTARGERQAAYDAGALPDFRVASRAIRETEWRVAPLPAA
LRDRRVEITGPVDPKMVINALNSGANCYMADFEDSTAPTWHNLLTGQRALRDAVAGTLEF
NAPGGKRYTLRPEDQRAVLLVRPRGWHLDEKHVCIGDGPGAGSQAPMSAALFDAGLFAFH
NAHALAAKDRGPYFYIPKLESADEARLWDDVLAYIERRLGLPGGQIRVTVLIETLPAVFE
MDEILHALKDRVAGLNCGRWDYIFSYIKTFRRHRDRVLPERAQVTMAQPFLKAYSELLIQ
TCHRRGAHAMGGMAAQIPIADDATANEIAMSRVRADKLREVTAGHDGTWVAHPALIPLAR
QVFDERMRGPHQHAMTRDDVLVDRDDLIAPPIGTISRAGFDGNVEVCVRYIAAWLDGNGC
VPIHHMMEDAATAEIARAQLWQWIHYADDGHAPLHLDDGTAIDAALLDRVLLGLPSKLAG
LDIPGAARVPEAIAMLEALTLRETLEDFLTVPAYARLP
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgctaagcattgacataactggattgtcaaatagccgcgccgggcggaccgtcggcaac
acccgctccgccgagcgcgacaaggatccgcagcctgtgaatgccgtcatcaaaaccgcc
ccgtctgccgatgcaccccgcttcaccttgcccgccgacaccgcgaccgatctgctcgat
gccccggcgctggcgttcctggccgaactgcaccagcgtttcgaaccgcgccgacgggcc
ttgctcacggcccggggcgagcgccaggccgcatacgatgccggcgcgctcccggacttc
cgcgtcgccagccgggctatccgcgaaaccgaatggcgggtggcgccgctgccggcggcc
ctgcgcgaccgccgggtcgagatcaccgggccggtcgacccgaagatggtcatcaacgcg
ctgaactccggcgccaactgctacatggccgacttcgaggactcgaccgcccccacctgg
cacaacctgctgaccggacagcgcgcactgcgcgatgccgttgccggcaccctggaattc
aacgcgccgggcggcaagcgctacacgctcaggcccgaggaccagcgcgccgtgctgctg
gtgcggccccgcggctggcacctcgacgagaagcacgtgtgcatcggcgacggcccgggc
gccgggtcacaggcgccgatgtcggctgcgctgttcgacgcgggcctgttcgcgttccac
aacgcccatgcgctggcggcgaaggatcgcggcccgtacttctacatccccaagctggaa
tcggcggacgaggcccggctgtgggacgacgtactggcctatatcgagcgcaggctcggc
ctgccgggcggccagatccgcgtcaccgtgctgatcgaaacgctgcctgcggtgttcgag
atggacgagatcctgcacgcgctcaaggaccgcgtcgcgggcctcaactgcggccgctgg
gactacatcttctcctacatcaagaccttccggcggcaccgcgaccgcgtactgcccgag
cgcgcccaggtcacgatggcgcagccgttcctcaaggcgtactccgagctgctgatccag
acctgtcatcgccgcggcgcgcacgcgatgggcggcatggccgcgcagatcccgatcgcc
gacgatgcgaccgccaacgagatcgcgatgtcgcgcgtgcgcgccgacaagctgcgcgag
gtcaccgcgggccatgacggcacctgggtcgcgcacccggcgctgatcccactggccagg
caggtcttcgacgagcgcatgcgcggcccgcaccagcacgcgatgacgcgtgatgacgtg
ctggtcgaccgggacgatctgatcgcgccgccgatcggcacgatcagccgggcagggttc
gacggcaatgtcgaggtctgtgtgcgctacatcgccgcctggctcgacggcaatggctgc
gtaccgatccaccacatgatggaggacgcggcgaccgccgagatcgcacgcgcgcagttg
tggcaatggatccactacgccgacgacggccacgcgccgctgcatctcgacgacggcacc
gcgatcgatgccgcgctgctggaccgcgtgctgctgggcctgccctcgaagctggcgggc
ctggacatcccgggagcggcccgcgtgccggaggccatcgcgatgctggaggcactgacg
ctgcgcgagaccctcgaagacttcctcaccgtgccggcctacgcgcgcctgccctga

DBGET integrated database retrieval system