KEGG   Luteimonas sp. S-1072: E5843_02740Help
Entry
E5843_02740       CDS       T05957                                 

Gene name
acnD
Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
lus  Luteimonas sp. S-1072
Pathway
lus00640  Propanoate metabolism
lus01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lus00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    E5843_02740 (acnD)
Enzymes [BR:lus01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     E5843_02740 (acnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: QCU72380
Position
512423..515032
Genome map
AA seq 869 aa AA seqDB search
MNNPYRKPLPGTPLAYFDAREAIEAIQPGAWAGLPYTARVHAENLVRCADPAQLRDYLVQ
LVERRRDLDFPWWPVRVVCHDILGQTALVDLAGLRDAIAEQGGDPAQVNPVVPVQLIVDH
SLAVECGGFDPDAFTRNREIEDRRNADRFDFIEWTRHAFRNVEVIPPGNGIMHQINLEKM
SPVVYVRDSVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELTGRPGPGITATDVVLALTEFLRAERVVGAYLEFFGEGASALTIGDRATISNMCPEYGA
TAAMFYIDEQTLDYLRLTGREDQQVALVETYARTAGLWADDLRDVRYERVLRFDLSSVVR
NMAGPSNPHRRLPTSALAERGIAVDLEGARAQEAQGLMPDGAVIIAAITSCTNTSNPRNV
IAAGLLARNANARGLVRKPWVKTSLAPGSKAVELYLQESGLLPELEALGFGIVGFACTTC
NGMSGALDPAIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAGTV
RFDIEKDVLGIDADGHPVTLKDLWPSDAEIDAVVKASVKPEQFRQVYGPMFKLQVDSGPK
VPPLYDWRPMSTYIRRPPYWEGALAGERTLAGMRALAVLGDNITTDHLSPSNAILRDSAA
GEYLASMGVPEEDFNSYATHRGDHLTAQRATFANPKLINEMAVVDGVVKQGSLARLEPEG
KVMRMWEVIETYMQRKQPLVIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTN
LVGMGVLPLEFKPGTTRLTLGIDGSETFDVIGTRAPGATLTLVIHRRNGETVEVPVTCRL
DSDEDVEVYEAGGVLQRFAQDFLASAKAA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccgtaccgcaagccgcttcccggcaccccgctcgcgtacttcgatgcccgc
gaggcgatcgaggcgatccagcccggcgcgtgggccggtctgccctacacggcgcgcgtg
catgcggaaaacctggtgcgctgcgcggacccggcacagttgcgcgactacctggtgcag
ctcgtcgagcgccgccgcgacctcgatttcccgtggtggccggtgcgcgtggtctgccac
gacatcctcggccagaccgcgctggtggacctcgccggcctgcgcgatgcgatcgccgag
cagggtggcgatccggcacaggtcaatccggtggtgccggtgcagctgatcgtcgaccac
tcgctggcagtggagtgcggcggcttcgaccccgatgcgttcacccgcaaccgcgagatc
gaggatcgccgcaacgccgaccgcttcgacttcatcgagtggacgcggcatgcgttccgc
aacgtggaggtgatcccgccgggcaacgggatcatgcaccagatcaacctggagaagatg
tcgccggtggtctacgtgcgcgacagcgtcgccttcccggacacctgcgtcggcaccgac
agccacaccccgcacgtcgacgcgctcggcgtgatcgcgatcggcgtcggcgggctggaa
gccgagaacgtcatgctcggccgcgcctcgtggatgcgcctgcccgacatcgtcggcgtc
gaactcaccggacgcccgggccccggcatcaccgccaccgacgtggtgctggcgctgacc
gaattcctgcgcgcggagcgcgtggtcggtgcttatctcgagttcttcggcgaaggggcc
tcggcgctgaccatcggcgaccgcgcgacgatctcgaacatgtgcccggaatacggcgcc
accgcggcgatgttctacatcgacgagcagaccctggactacctgcgcctgaccggccgc
gaggaccagcaggtcgcgctggtggagacctatgcgaggaccgccggcctgtgggccgac
gacctgcgcgacgtgcggtacgagcgcgtgctgcgcttcgacctgtcgagcgtggtgcgc
aacatggccgggccgtcgaatccgcaccgccggctgccgacctcggcactggcggagcgc
ggcatcgcggtggatctcgaaggcgcgcgtgcgcaggaagcgcagggcctgatgcccgat
ggcgcggtgatcatcgccgccatcaccagctgcaccaacacctccaacccgcgcaacgtg
atcgccgccggcctgctggcgcgcaacgccaacgcgcgcggactcgtgcgcaagccgtgg
gtgaaaacctcgctcgcgccgggttcgaaggcggtcgagctgtatctgcaggaaagcggc
ctgttgccggaactcgaagcgctgggcttcggcatcgtcggcttcgcctgcaccacctgc
aatggcatgagcggcgcgctggatcccgcgatccagcaggagatcatcgaccgcgacctg
tatgcgaccgcggtgctgtcgggcaaccgcaacttcgacggccgcatccatccgtatgcc
aagcaggccttcctggcctcgccgccgctggtgatcgcgtatgcgatcgccggcaccgtg
cgtttcgacatcgagaaggacgtgctgggtatcgatgccgacggccatccggtgacgctc
aaggacctgtggcccagcgacgccgagatcgacgcggtggtcaaggccagcgtcaagccg
gagcagttccgccaggtgtacgggccgatgttcaagctgcaggtcgacagcgggccgaag
gtgccgccgctgtacgactggcggccgatgtcgacctacatccgccgcccgccgtactgg
gaaggcgcgctcgccggcgagcgcacgctggccggcatgcgtgcgctggcggtgctgggc
gacaacatcaccaccgatcacctgtcgccgtcgaacgcgatcctgcgcgacagcgcggcc
ggtgaatacctggcgtcgatgggcgtgccggaggaggacttcaactcctacgccacccat
cgcggcgaccacctcactgcgcagcgcgccaccttcgccaatcccaagctcatcaacgag
atggcggtggtcgacggcgttgtgaagcagggctccttggcgcggctggagccggaaggc
aaggtcatgcgcatgtgggaagtgatcgagacctacatgcagcgcaagcagccgctggtg
atcatcgccggcgccgactacggccagggctcgtcgcgcgactgggcagccaagggcgtg
cggctggcgggcgtggaggcgatcgtcgccgagggtttcgagcgcatccaccgcaccaac
ctggtcggcatgggcgtgctgccgcttgagttcaagccgggcaccacgcggctgacgctc
ggcatcgacggcagcgagacgttcgacgtgatcggcacccgcgcgccgggcgccacgctg
acgctggtgatccaccgccgcaacggcgagaccgtcgaagtgccggtgacctgccgtctg
gattccgacgaggacgtcgaggtctacgaggccggcggcgtgctgcagcgtttcgcgcag
gacttcctcgcttcggcgaaggcggcctga

DBGET integrated database retrieval system