KEGG   Luteimonas sp. S-1072: E5843_10690Help
Entry
E5843_10690       CDS       T05957                                 

Gene name
phoR
Definition
(GenBank) phosphate regulon sensor histidine kinase PhoR
  KO
K07636  two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC:2.7.13.3]
Organism
lus  Luteimonas sp. S-1072
Pathway
lus02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E5843_10690 (phoR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lus01001]
    E5843_10690 (phoR)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lus02022]
    E5843_10690 (phoR)
Enzymes [BR:lus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     E5843_10690 (phoR)
Protein kinases [BR:lus01001]
 Histidine kinases
  OmpR family
   E5843_10690 (phoR)
Two-component system [BR:lus02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   E5843_10690 (phoR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PhoR PAS_8 HATPase_c_2 HATPase_c_3 PAS Popeye Lebercilin
Motif
Other DBs
NCBI-ProteinID: QCO68108
Position
2198875..2200239
Genome map
AA seq 454 aa AA seqDB search
MPPRLAAGWARTLGRQVLVLAAALVLGLMVDQAWAALALAALGIVAWQQLRLRRLLLRLQ
SRRHLPLARGAGAWNELDRLLHQYQDETRNRKRRLVEMLRAYRAAAAALPDAVVVLDRNS
QRVQWFNEAASHLLGLQYPADLDAPVGERLQPLPIAHWLASGRYAEPLLDAPSPMDADVR
LSLRLIPYSDSLWLMVARDVSKLMRLEQVRRDFVANVSHELRTPLTVIHGYLDMLEPDEQ
PDWAPILAEMRTQSQRMTQLVEDLLTLSRLEAQEAVSDENVPMASLLATLRREAEALGKG
RHEIRVEDRAGVDLWGSIKELHSAFSNLVSNAVRYTPAGGRIDITLARSDDGGAVLSVRD
SGYGIPASHLPRLTERFYRVSTSRSRELGGTGLGLAIVKHVLQLHQARLEVESEVGRGSM
FACHFPPDRVHSPRDPFIDGAPREQARNPADRAR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgcgactcgccgccggctgggcccgtacgctcgggcgccaggtcctggtcctg
gcggccgcgctcgtcctggggctgatggtcgaccaggcctgggcggcactggcgctggcc
gcgctgggcatcgtggcctggcagcaactgcgcctgcgacgcctgctgctgcgcctgcag
tcacgccggcacctgccactcgcacgcggggcgggcgcatggaacgagctcgaccgcctg
ctgcaccagtaccaggacgaaacccgcaaccgcaagcgccggctggtggagatgctgcgc
gcctaccgcgcggccgccgcggcgctgcccgacgcggtggtggtgctggaccgcaacagc
cagcgcgtgcagtggttcaacgaggcggccagccatctgctcggcctgcagtacccggcc
gacctcgacgccccggtcggcgagcgcctgcaaccgctgcccatcgcccactggctggcc
agtggccgttacgccgaacccctgctcgatgcgccatcgccgatggatgccgacgtccgc
ctgagcctgcggttgattccgtattcggacagcctgtggctgatggtcgcgcgcgacgtg
agcaagctgatgcggctggaacaggtacgccgcgatttcgtcgccaacgtgtcccacgaa
ctgcgtacgccgctgacggtcatccatggctatctcgacatgctcgagcccgacgagcag
cccgactgggcgccgatcctggccgagatgcgcacgcagtcgcagcgcatgacccagctg
gtggaggacctgctgacgctgtcgcggctggaggcgcaggaggcggtgtccgacgagaac
gtgccaatggcatcgctgctcgccaccctgcgccgcgaggccgaagcactgggcaagggc
cgccacgagatccgcgtcgaggaccgagcgggcgtggacctgtggggctcgatcaaggag
ctgcacagcgcgttctccaacctcgtgtcgaacgccgtgcgctatacccccgccggcggc
cgcatcgacatcacgcttgcacgcagcgacgacggtggcgccgtgctgtcggtgcgcgac
agcggctacggcatccccgcctcgcacctgccgcgcctgaccgaacgcttctaccgggtg
tccaccagccgctcgcgcgaactcggcgggaccggcctcgggcttgccatcgtcaaacac
gtgcttcagctgcaccaggcgcggctggaagtcgaaagcgaggtcggccgcggcagcatg
ttcgcctgccatttcccccccgaccgcgtacattccccgcgagatccctttatcgatgga
gccccgcgtgaacaagcgcgcaacccggccgaccgcgcacgctga

DBGET integrated database retrieval system