KEGG   Luteimonas sp. S-1072: E5843_11395Help
Entry
E5843_11395       CDS       T05957                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lus  Luteimonas sp. S-1072
Pathway
lus03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lus00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    E5843_11395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lus03011]
    E5843_11395
Ribosome [BR:lus03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    E5843_11395
  Bacteria
    E5843_11395
  Archaea
    E5843_11395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: QCO68214
Position
complement(2343285..2343620)
Genome map
AA seq 111 aa AA seqDB search
MEAKAILRSARISAQKARLVADQVRGLPAERAVNLLKFSDKKAAHLIKKVVESAIANAEN
NQGADVDELKVKTIMVDEGPTLKRFMARAKGRGTRILKRTSHITVVVGEGK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcaatcctgcgcagtgcgcgcatctccgcccagaaggcacgcctggtc
gccgaccaggtgcgcggcctgccggccgagcgcgccgtcaacctgctgaagttctcggac
aagaaggctgcccacctgatcaagaaggtggtggagtcggcgatcgccaatgccgagaac
aaccagggcgccgatgtcgacgagctgaaggtcaagaccatcatggtcgacgagggtccc
acgctgaagcgcttcatggcgcgtgcgaagggtcgcggcacccgcatcctgaagcggacc
agccacatcaccgtcgtcgtcggagagggcaagtaa

DBGET integrated database retrieval system