KEGG   Lutibacter profundi: Lupro_04115Help
Entry
Lupro_04115       CDS       T04235                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
lut  Lutibacter profundi
Pathway
lut00310  Lysine degradation
lut01100  Metabolic pathways
lut01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Lupro_04115
Enzymes [BR:lut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     Lupro_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_3 NAD_binding_8 Mqo Thi4 FAD_binding_2 HI0933_like Pyr_redox_2 EutN_CcmL
Motif
Other DBs
NCBI-ProteinID: AMC10486
UniProt: A0A0X8G5J6
Position
complement(938440..939648)
Genome map
AA seq 402 aa AA seqDB search
MLNKKYDFIVVGAGIVGLATAYKLQLKFPKKSIVILEKEAKVGMHQTGRNSGVMHSGIYY
TPGSYKAINCKNGRNQLIEFAKKNEIKHDICGKVIVATKQEDISVLEDIYAKGIENETEG
IRFLNSEEIKEKEPFVEAVKAIWVPTAGIIDYVAVSNKLVELVENLNSKSKLLINCKVEN
ISSKENETIVHTSLGNLTAEKVIFCTGLQSDRNAEKDDLKLDMHIVGFRGDYYELTDEAS
HKINNLVYPVPDPKYPFLGVHFTRMINGGVECGPNAVFTFKREGYKRTSFSFRDTFDALT
FGGTWKLFFKNWRKGIDEYKRAFSKRLFVNALKHMMPSITPNDVQPSRAGVRAQAIDYDG
NMVDDFKIMKHNGNIHVLNAPSPAATSCLAIADEIVSVVLNK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataaaaagtacgattttattgttgttggagcaggaattgttggattggctaca
gcctataaattacaattgaaatttcctaaaaaatcaatagtaattttagaaaaagaagct
aaagtagggatgcatcaaacaggaagaaattctggagttatgcactctggaatatattat
acacctggctcttacaaagcaattaattgtaaaaacggaagaaatcaactcattgagttt
gctaaaaaaaatgagattaaacacgatatttgtggaaaagtaattgtagctacaaaacaa
gaagatatttcggttttagaagatatttatgctaaaggaatagaaaatgaaaccgaagga
atacgatttttaaattctgaagaaataaaagaaaaagaaccttttgttgaagctgttaaa
gctatttgggtaccaacagcaggtattattgattatgtagcagtttcaaataaacttgta
gaattagttgagaatttaaattcaaaaagtaaattactaatcaattgtaaagtagaaaat
atttcttcaaaagagaatgaaacaattgttcatacttcattaggtaatttaactgctgaa
aaagtaattttctgcacagggttacaatctgatagaaatgcagaaaaagatgatttaaaa
ttagatatgcatattgtaggttttagaggtgattattacgaactaaccgatgaagcttca
cataaaataaataatttagtatatccagttcctgatccaaaatatccttttttaggagtt
cattttacacgaatgattaatggtggagttgaatgtggtccaaatgcggtatttaccttt
aaacgagagggttataaaagaacaagttttagctttagagatacttttgatgccttaact
tttggtggtacttggaaattattttttaagaattggcgcaaaggaattgatgaatataaa
agagccttttcaaaacgtttatttgtaaatgcactaaaacatatgatgcctagtattacg
ccaaatgatgtgcagccatcaagagcaggagtgagagcacaggcaattgattacgatggt
aatatggttgatgattttaaaattatgaaacataacggaaacattcacgtgttaaatgcc
ccttcgccagcagcgacttcctgtttagcaattgccgatgaaattgtaagtgtagtttta
aataaataa

DBGET integrated database retrieval system